BLASTX nr result
ID: Ophiopogon26_contig00055773
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055773 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY42799.1| hypothetical protein RhiirA4_456658 [Rhizophagus ... 59 2e-08 gb|PKC68434.1| hypothetical protein RhiirA1_440618 [Rhizophagus ... 60 4e-08 dbj|GBC19354.1| Tis13_3930: PROVISIONAL [Rhizophagus irregularis... 54 1e-06 >gb|PKY42799.1| hypothetical protein RhiirA4_456658 [Rhizophagus irregularis] Length = 98 Score = 58.5 bits (140), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -3 Query: 395 TNQMVNQMIKKNKRPRKHEVGDLMKISIPKIDGSG 291 TN+M NQM KKNKRP K+EVGDL++ISIPKID SG Sbjct: 27 TNKMANQMKKKNKRPNKYEVGDLVRISIPKIDRSG 61 >gb|PKC68434.1| hypothetical protein RhiirA1_440618 [Rhizophagus irregularis] Length = 174 Score = 59.7 bits (143), Expect = 4e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 313 FQKLMVLEKFSHLVQMSFHELNNLPSNKISVREV 212 F+ ++ LEKFSHLVQMSFHELNNLPSNKISVR+V Sbjct: 137 FRVIIHLEKFSHLVQMSFHELNNLPSNKISVRDV 170 >dbj|GBC19354.1| Tis13_3930: PROVISIONAL [Rhizophagus irregularis DAOM 181602] gb|POG64395.1| hypothetical protein GLOIN_2v1782991 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 118 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 386 MVNQMIKKNKRPRKHEVGDLMKISIPKIDGSG 291 M NQM KKNKRP K+EVGDL++ISIPKID SG Sbjct: 1 MANQMKKKNKRPNKYEVGDLLRISIPKIDRSG 32