BLASTX nr result
ID: Ophiopogon26_contig00055700
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055700 (405 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG65938.1| hypothetical protein GLOIN_2v1662242 [Rhizophagus... 60 6e-10 >gb|POG65938.1| hypothetical protein GLOIN_2v1662242 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 64 Score = 60.5 bits (145), Expect(2) = 6e-10 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 52 FFIIISTSVLATQPLFPRHGLAFNNHKYLG 141 ++IIISTS+LATQPLFPR+GLAFNNHKYLG Sbjct: 31 YYIIISTSILATQPLFPRYGLAFNNHKYLG 60 Score = 30.8 bits (68), Expect(2) = 6e-10 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +2 Query: 8 LSSQPQGIFPTVKKTFSL 61 L QPQGIFPTVKK F L Sbjct: 13 LIPQPQGIFPTVKKLFHL 30