BLASTX nr result
ID: Ophiopogon26_contig00055614
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055614 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC56605.1| hypothetical protein RhiirA1_473753 [Rhizophagus ... 58 3e-07 >gb|PKC56605.1| hypothetical protein RhiirA1_473753 [Rhizophagus irregularis] Length = 520 Score = 57.8 bits (138), Expect = 3e-07 Identities = 30/66 (45%), Positives = 45/66 (68%) Frame = +2 Query: 17 DEIDTFFQSPPDLYKEVKTMSKKRRSMRYTGITKGAKRNRPSNQNDIVDADQSASDQSEN 196 DEID FF+ PP++ K+ K S+KR SM+ TG +K KRN+ S ND DA+Q+ D+S+ Sbjct: 236 DEIDDFFRGPPNVVKDAKLKSRKRGSMKGTG-SKSVKRNKSS--NDAEDAEQTTCDESDV 292 Query: 197 VDKSTD 214 + +T+ Sbjct: 293 EENTTE 298