BLASTX nr result
ID: Ophiopogon26_contig00055511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055511 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK55912.1| hypothetical protein RhiirC2_801181 [Rhizophagus ... 57 2e-07 >gb|PKK55912.1| hypothetical protein RhiirC2_801181 [Rhizophagus irregularis] Length = 150 Score = 57.0 bits (136), Expect = 2e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -2 Query: 399 KDTQKYNSNSSISQ*LFTLLIFGYTNLEKTNKILNLVTGRLL 274 KD QKYN+NSSI Q FTLLI G TNLEKTN++LNL+ G L Sbjct: 20 KDAQKYNTNSSILQWPFTLLICGCTNLEKTNEVLNLMLGNKL 61