BLASTX nr result
ID: Ophiopogon26_contig00055504
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00055504 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC23614.1| hypothetical protein RIR_1042500 [Rhizophagus ir... 80 2e-15 >dbj|GBC23614.1| hypothetical protein RIR_1042500 [Rhizophagus irregularis DAOM 181602] Length = 331 Score = 80.1 bits (196), Expect(2) = 2e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 33 LFKVSTYTFYNNTLHENFIIPIFASSVCGINISIFRSKH 149 LFKV+TY FYNNTLHENFIIPIFASSVCGINISIFRSKH Sbjct: 279 LFKVTTYIFYNNTLHENFIIPIFASSVCGINISIFRSKH 317 Score = 29.6 bits (65), Expect(2) = 2e-15 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 152 NWFISSNKNGMKS 190 NWFISSNKN MKS Sbjct: 319 NWFISSNKNDMKS 331