BLASTX nr result
ID: Ophiopogon26_contig00054862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054862 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG67890.1| hypothetical protein GLOIN_2v266175 [Rhizophagus ... 104 6e-24 dbj|GBC12920.1| Glutamate dehydrogenase NAD(P)+ [Rhizophagus irr... 104 7e-24 gb|PKC11965.1| 30S ribosomal protein S12 [Rhizophagus irregulari... 53 3e-06 gb|EXX71071.1| hypothetical protein RirG_081720 [Rhizophagus irr... 53 7e-06 >gb|POG67890.1| hypothetical protein GLOIN_2v266175 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 445 Score = 104 bits (260), Expect = 6e-24 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +3 Query: 216 MSSNLIKPSILSHSPKSFISVLKSHGITKFHLHFNRKTSRVIASHPILQPIG 371 MSSNLIKPSILSHSPKSFISVLKSHGITKFHLHFNRKT RVIASHPILQPIG Sbjct: 1 MSSNLIKPSILSHSPKSFISVLKSHGITKFHLHFNRKTRRVIASHPILQPIG 52 >dbj|GBC12920.1| Glutamate dehydrogenase NAD(P)+ [Rhizophagus irregularis DAOM 181602] Length = 460 Score = 104 bits (260), Expect = 7e-24 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +3 Query: 216 MSSNLIKPSILSHSPKSFISVLKSHGITKFHLHFNRKTSRVIASHPILQPIG 371 MSSNLIKPSILSHSPKSFISVLKSHGITKFHLHFNRKT RVIASHPILQPIG Sbjct: 1 MSSNLIKPSILSHSPKSFISVLKSHGITKFHLHFNRKTRRVIASHPILQPIG 52 >gb|PKC11965.1| 30S ribosomal protein S12 [Rhizophagus irregularis] gb|PKC60025.1| 30S ribosomal protein S12 [Rhizophagus irregularis] gb|PKK65853.1| 30S ribosomal protein S12 [Rhizophagus irregularis] gb|PKY28644.1| 30S ribosomal protein S12 [Rhizophagus irregularis] gb|PKY45369.1| 30S ribosomal protein S12 [Rhizophagus irregularis] gb|POG67891.1| 30S ribosomal protein S12 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 120 Score = 52.8 bits (125), Expect = 3e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 1 DFAGVPNRTTSRSKYGTKKPKAPTK 75 DFAGVPNRTTSRSKYGTKKPKA TK Sbjct: 96 DFAGVPNRTTSRSKYGTKKPKATTK 120 >gb|EXX71071.1| hypothetical protein RirG_081720 [Rhizophagus irregularis DAOM 197198w] gb|EXX71072.1| hypothetical protein RirG_081720 [Rhizophagus irregularis DAOM 197198w] dbj|GBC12921.1| Putative mitochondrial 37S ribosomal protein MRPS12 [Rhizophagus irregularis DAOM 181602] Length = 165 Score = 52.8 bits (125), Expect = 7e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = +1 Query: 1 DFAGVPNRTTSRSKYGTKKPKAPTK 75 DFAGVPNRTTSRSKYGTKKPKA TK Sbjct: 141 DFAGVPNRTTSRSKYGTKKPKATTK 165