BLASTX nr result
ID: Ophiopogon26_contig00054726
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054726 (396 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX59687.1| hypothetical protein RirG_186840 [Rhizophagus irr... 132 2e-35 >gb|EXX59687.1| hypothetical protein RirG_186840 [Rhizophagus irregularis DAOM 197198w] gb|POG77898.1| hypothetical protein GLOIN_2v1542388 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 297 Score = 132 bits (333), Expect = 2e-35 Identities = 63/69 (91%), Positives = 65/69 (94%) Frame = +1 Query: 1 GFSYIFNFEPQRNLYSPLTFSVAQYAIFMVSIPNFDWAEDVRDFIPDSLIYTGAGTGAIF 180 GFSYIFNFEP RNLYSPLTFSVAQYAIFMVS+ NFDWAEDVRDFIPD+LIY GAGTGAIF Sbjct: 225 GFSYIFNFEPHRNLYSPLTFSVAQYAIFMVSVSNFDWAEDVRDFIPDNLIYMGAGTGAIF 284 Query: 181 ALYESILEN 207 ALYESIL N Sbjct: 285 ALYESILAN 293