BLASTX nr result
ID: Ophiopogon26_contig00054655
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054655 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG68059.1| hypothetical protein GLOIN_2v249001 [Rhizophagus ... 61 3e-09 >gb|POG68059.1| hypothetical protein GLOIN_2v249001 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 98 Score = 61.2 bits (147), Expect = 3e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 445 FFI*KLILNSYNINAKKFYKRVDDSLFSNQIRSMEGME 332 F ++ LNSYNINAKKFYKRV+DSLFSNQIRSMEG E Sbjct: 57 FLYLEINLNSYNINAKKFYKRVNDSLFSNQIRSMEGNE 94