BLASTX nr result
ID: Ophiopogon26_contig00054604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054604 (470 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65720.1| uncharacterized protein A4U43_C06F240 [Asparagus ... 64 7e-09 >gb|ONK65720.1| uncharacterized protein A4U43_C06F240 [Asparagus officinalis] Length = 510 Score = 63.9 bits (154), Expect = 7e-09 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -1 Query: 374 CFVCSIIYAIFLNETHKNNSQSCTVPTIISMKRSDLSTRADLKWLVKS 231 CFVC+I+YA FL+ T +NNSQS VP IISMKR++L+TR +LKWLVKS Sbjct: 162 CFVCAIMYAFFLSMT-RNNSQSYVVP-IISMKRAELATRPELKWLVKS 207