BLASTX nr result
ID: Ophiopogon26_contig00054563
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054563 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC61940.1| hypothetical protein RhiirA1_465816 [Rhizophagus ... 66 9e-11 dbj|GBC46325.1| Tis13_95604 [Rhizophagus irregularis DAOM 181602... 66 3e-10 gb|PKK75574.1| hypothetical protein RhiirC2_773496 [Rhizophagus ... 63 4e-09 >gb|PKC61940.1| hypothetical protein RhiirA1_465816 [Rhizophagus irregularis] gb|PKY15695.1| hypothetical protein RhiirB3_427932 [Rhizophagus irregularis] Length = 123 Score = 65.9 bits (159), Expect = 9e-11 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -1 Query: 177 KRPKRKSTKSTNENDDNDQITDEQIAHFDNIFHNLDPENMWTLKSGRVV 31 KRPKRKST N D+++I+DEQIAHF++IF NL+PE MWT KSGR++ Sbjct: 13 KRPKRKST-----NIDDNRISDEQIAHFNHIFCNLNPEKMWTFKSGRII 56 >dbj|GBC46325.1| Tis13_95604 [Rhizophagus irregularis DAOM 181602] gb|PKC08615.1| hypothetical protein RhiirA5_416683 [Rhizophagus irregularis] Length = 179 Score = 65.9 bits (159), Expect = 3e-10 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = -1 Query: 177 KRPKRKSTKSTNENDDNDQITDEQIAHFDNIFHNLDPENMWTLKSGRVV 31 KRPKRKST N D+++I+DEQIAHF++IF NL+PE MWT KSGR++ Sbjct: 13 KRPKRKST-----NIDDNRISDEQIAHFNHIFCNLNPEKMWTFKSGRII 56 >gb|PKK75574.1| hypothetical protein RhiirC2_773496 [Rhizophagus irregularis] Length = 176 Score = 62.8 bits (151), Expect = 4e-09 Identities = 29/49 (59%), Positives = 41/49 (83%) Frame = -1 Query: 177 KRPKRKSTKSTNENDDNDQITDEQIAHFDNIFHNLDPENMWTLKSGRVV 31 ++PKR KST+ +D+ +I+DEQIAHF++IF NL+PE MWTLKSGR++ Sbjct: 10 EKPKRLKRKSTDIDDN--RISDEQIAHFNHIFCNLNPEKMWTLKSGRII 56