BLASTX nr result
ID: Ophiopogon26_contig00054547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054547 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCI50756.1| unnamed protein product [Albugo candida] 95 3e-23 gb|POM80598.1| 60S ribosomal protein L29 [Phytophthora palmivora... 94 5e-23 ref|XP_002902725.1| hypothetical protein PITG_10202 [Phytophthor... 94 6e-23 ref|XP_009531397.1| hypothetical protein PHYSODRAFT_286711 [Phyt... 94 6e-23 gb|KUF80498.1| 60S ribosomal protein L29-1 [Phytophthora nicotia... 94 6e-23 gb|OWZ00931.1| hypothetical protein PHMEG_00027775 [Phytophthora... 94 7e-23 emb|CCA21676.1| hypothetical protein PITG_10202 [Albugo laibachi... 94 8e-23 dbj|GAX97991.1| Hypothetical protein PINS_005835 [Pythium insidi... 92 3e-22 gb|OQR93820.1| hypothetical protein THRCLA_22279 [Thraustotheca ... 92 6e-22 gb|OQR87268.1| hypothetical protein ACHHYP_09309 [Achlya hypogyna] 92 6e-22 ref|XP_008618368.1| 50S ribosomal protein L29e [Saprolegnia dicl... 92 6e-22 ref|XP_008880552.1| hypothetical protein H310_14464 [Aphanomyces... 89 7e-21 ref|XP_009839152.1| hypothetical protein H257_13356 [Aphanomyces... 87 4e-20 ref|XP_010671671.1| PREDICTED: 60S ribosomal protein L29-1 [Beta... 81 7e-18 ref|XP_021595046.1| 60S ribosomal protein L29-1-like [Manihot es... 80 2e-17 gb|EPS58528.1| hypothetical protein M569_16287, partial [Genlise... 80 3e-17 ref|XP_022157681.1| 60S ribosomal protein L29-1-like [Momordica ... 79 6e-17 ref|XP_020555125.1| 60S ribosomal protein L29-1, partial [Sesamu... 79 6e-17 ref|XP_020697793.1| LOW QUALITY PROTEIN: 60S ribosomal protein L... 79 6e-17 gb|PNY14845.1| 60S ribosomal protein l29-1-like [Trifolium prate... 79 8e-17 >emb|CCI50756.1| unnamed protein product [Albugo candida] Length = 65 Score = 95.1 bits (235), Expect = 3e-23 Identities = 42/46 (91%), Positives = 46/46 (100%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARNNTVKAH+NGIK+PKNHR+HSTRGLDPKFLRNQR+A Sbjct: 1 MVKQKNHTARNNTVKAHRNGIKRPKNHRFHSTRGLDPKFLRNQRWA 46 >gb|POM80598.1| 60S ribosomal protein L29 [Phytophthora palmivora var. palmivora] Length = 62 Score = 94.4 bits (233), Expect = 5e-23 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARNNTVKAH+NGIKKPKNHR+HSTRGLDPKFLRNQ +A Sbjct: 1 MVKQKNHTARNNTVKAHRNGIKKPKNHRFHSTRGLDPKFLRNQHWA 46 >ref|XP_002902725.1| hypothetical protein PITG_10202 [Phytophthora infestans T30-4] ref|XP_008893586.1| hypothetical protein PPTG_01945 [Phytophthora parasitica INRA-310] gb|EEY56651.1| hypothetical protein PITG_10202 [Phytophthora infestans T30-4] gb|ETI44788.1| hypothetical protein F443_10543 [Phytophthora parasitica P1569] gb|ETK84759.1| hypothetical protein L915_10302 [Phytophthora parasitica] gb|ETL38177.1| hypothetical protein L916_10205 [Phytophthora parasitica] gb|ETL91312.1| hypothetical protein L917_10141 [Phytophthora parasitica] gb|ETM44622.1| hypothetical protein L914_10163 [Phytophthora parasitica] gb|ETN21862.1| hypothetical protein PPTG_01945 [Phytophthora parasitica INRA-310] gb|ETO73398.1| hypothetical protein F444_10642 [Phytophthora parasitica P1976] gb|ETP14573.1| hypothetical protein F441_10482 [Phytophthora parasitica CJ01A1] gb|ETP42654.1| hypothetical protein F442_10439 [Phytophthora parasitica P10297] emb|CEG40364.1| 60s ribosomal protein l29-1-like [Plasmopara halstedii] Length = 63 Score = 94.4 bits (233), Expect = 6e-23 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARNNTVKAH+NGIKKPKNHR+HSTRGLDPKFLRNQ +A Sbjct: 1 MVKQKNHTARNNTVKAHRNGIKKPKNHRFHSTRGLDPKFLRNQHWA 46 >ref|XP_009531397.1| hypothetical protein PHYSODRAFT_286711 [Phytophthora sojae] gb|EGZ13968.1| hypothetical protein PHYSODRAFT_286711 [Phytophthora sojae] Length = 63 Score = 94.4 bits (233), Expect = 6e-23 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARNNTVKAH+NGIKKPKNHR+HSTRGLDPKFLRNQ +A Sbjct: 1 MVKQKNHTARNNTVKAHRNGIKKPKNHRFHSTRGLDPKFLRNQHWA 46 >gb|KUF80498.1| 60S ribosomal protein L29-1 [Phytophthora nicotianae] gb|KUF94531.1| Reticulocyte-binding protein 2 a [Phytophthora nicotianae] Length = 64 Score = 94.4 bits (233), Expect = 6e-23 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARNNTVKAH+NGIKKPKNHR+HSTRGLDPKFLRNQ +A Sbjct: 1 MVKQKNHTARNNTVKAHRNGIKKPKNHRFHSTRGLDPKFLRNQHWA 46 >gb|OWZ00931.1| hypothetical protein PHMEG_00027775 [Phytophthora megakarya] Length = 73 Score = 94.4 bits (233), Expect = 7e-23 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARNNTVKAH+NGIKKPKNHR+HSTRGLDPKFLRNQ +A Sbjct: 1 MVKQKNHTARNNTVKAHRNGIKKPKNHRFHSTRGLDPKFLRNQHWA 46 >emb|CCA21676.1| hypothetical protein PITG_10202 [Albugo laibachii Nc14] Length = 65 Score = 94.0 bits (232), Expect = 8e-23 Identities = 41/46 (89%), Positives = 46/46 (100%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARNNTVKAH+NGIK+P+NHR+HSTRGLDPKFLRNQR+A Sbjct: 1 MVKQKNHTARNNTVKAHRNGIKRPRNHRFHSTRGLDPKFLRNQRWA 46 >dbj|GAX97991.1| Hypothetical protein PINS_005835 [Pythium insidiosum] Length = 64 Score = 92.4 bits (228), Expect = 3e-22 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARNNTVKAHKNGI+KPKNHRY +T+GLDPKFLRNQR+A Sbjct: 1 MVKQKNHTARNNTVKAHKNGIRKPKNHRYRTTKGLDPKFLRNQRWA 46 >gb|OQR93820.1| hypothetical protein THRCLA_22279 [Thraustotheca clavata] Length = 59 Score = 91.7 bits (226), Expect = 6e-22 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARN TVKAHKNGI+KP HRYHST+GLDPKFLRNQRFA Sbjct: 1 MVKQKNHTARNQTVKAHKNGIRKPHKHRYHSTKGLDPKFLRNQRFA 46 >gb|OQR87268.1| hypothetical protein ACHHYP_09309 [Achlya hypogyna] Length = 60 Score = 91.7 bits (226), Expect = 6e-22 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARN TVKAHKNGI+KP HRYHST+GLDPKFLRNQRFA Sbjct: 1 MVKQKNHTARNQTVKAHKNGIRKPHKHRYHSTKGLDPKFLRNQRFA 46 >ref|XP_008618368.1| 50S ribosomal protein L29e [Saprolegnia diclina VS20] ref|XP_012204393.1| hypothetical protein SPRG_09577 [Saprolegnia parasitica CBS 223.65] gb|EQC28219.1| 50S ribosomal protein L29e [Saprolegnia diclina VS20] gb|KDO24933.1| hypothetical protein SPRG_09577 [Saprolegnia parasitica CBS 223.65] Length = 60 Score = 91.7 bits (226), Expect = 6e-22 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQKNHTARN TVKAHKNGI+KP HRYHST+GLDPKFLRNQRFA Sbjct: 1 MVKQKNHTARNQTVKAHKNGIRKPHKHRYHSTKGLDPKFLRNQRFA 46 >ref|XP_008880552.1| hypothetical protein H310_14464 [Aphanomyces invadans] gb|ETV90795.1| hypothetical protein H310_14464 [Aphanomyces invadans] Length = 60 Score = 89.0 bits (219), Expect = 7e-21 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQK+HTARN T KAHKNGI+KPKNHRY ST+GLDPKFLRNQRFA Sbjct: 1 MVKQKHHTARNQTFKAHKNGIRKPKNHRYKSTKGLDPKFLRNQRFA 46 >ref|XP_009839152.1| hypothetical protein H257_13356 [Aphanomyces astaci] gb|ETV71487.1| hypothetical protein H257_13356 [Aphanomyces astaci] Length = 61 Score = 87.0 bits (214), Expect = 4e-20 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 MVKQK+HTARN T KAHKNGI+KPK+HRY ST+GLDPKFLRNQRFA Sbjct: 1 MVKQKHHTARNQTFKAHKNGIRKPKDHRYKSTKGLDPKFLRNQRFA 46 >ref|XP_010671671.1| PREDICTED: 60S ribosomal protein L29-1 [Beta vulgaris subsp. vulgaris] gb|KMT16221.1| hypothetical protein BVRB_3g053800 [Beta vulgaris subsp. vulgaris] Length = 60 Score = 81.3 bits (199), Expect = 7e-18 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 M K KNHTA N + KAHKNGIKKP+ HR+HST+G+DPKFLRNQR+A Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPRRHRHHSTKGMDPKFLRNQRYA 46 >ref|XP_021595046.1| 60S ribosomal protein L29-1-like [Manihot esculenta] Length = 61 Score = 80.5 bits (197), Expect = 2e-17 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 M K KNHTA N + KAHKNGIKKPK HRY ST+G+DPKFLRNQR+A Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRYTSTKGMDPKFLRNQRYA 46 >gb|EPS58528.1| hypothetical protein M569_16287, partial [Genlisea aurea] Length = 60 Score = 79.7 bits (195), Expect = 3e-17 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 M K KNHTA N + KAHKNGIKKPK HR+ STRG+DPKFLRNQR+A Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTRGMDPKFLRNQRYA 46 >ref|XP_022157681.1| 60S ribosomal protein L29-1-like [Momordica charantia] Length = 60 Score = 79.0 bits (193), Expect = 6e-17 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 M K KNHTA N + KAHKNGIKKP+NHR+ ST+G+DPKFLRNQR+A Sbjct: 1 MAKSKNHTAHNQSHKAHKNGIKKPRNHRHTSTKGMDPKFLRNQRYA 46 >ref|XP_020555125.1| 60S ribosomal protein L29-1, partial [Sesamum indicum] Length = 47 Score = 78.6 bits (192), Expect = 6e-17 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 M K KNHTA N + KAHKNGIKKPK HR+ ST+G+DPKFLRNQR+A Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYA 46 >ref|XP_020697793.1| LOW QUALITY PROTEIN: 60S ribosomal protein L29-1-like [Dendrobium catenatum] Length = 62 Score = 79.0 bits (193), Expect = 6e-17 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 M K KNHTA N + KAHKNGIKKPK HR+ STRG+DPKFLRNQR+A Sbjct: 1 MAKSKNHTAHNQSHKAHKNGIKKPKRHRHTSTRGMDPKFLRNQRYA 46 >gb|PNY14845.1| 60S ribosomal protein l29-1-like [Trifolium pratense] Length = 60 Score = 78.6 bits (192), Expect = 8e-17 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 386 MVKQKNHTARNNTVKAHKNGIKKPKNHRYHSTRGLDPKFLRNQRFA 249 M K KNHTA N + KAHKNGIKKPK HR+ ST+G+DPKFLRNQR+A Sbjct: 1 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYA 46