BLASTX nr result
ID: Ophiopogon26_contig00054506
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054506 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX79481.1| hypothetical protein RirG_005160 [Rhizophagus irr... 141 5e-41 >gb|EXX79481.1| hypothetical protein RirG_005160 [Rhizophagus irregularis DAOM 197198w] dbj|GBC38472.1| hypothetical protein RIR_2239200 [Rhizophagus irregularis DAOM 181602] Length = 101 Score = 141 bits (356), Expect = 5e-41 Identities = 66/100 (66%), Positives = 83/100 (83%), Gaps = 1/100 (1%) Frame = +2 Query: 17 MCDV-VYIPHKPDYENYHYFAINLITQIVPEPSPEAYLEKLSRRNPEIEYIGPIGHLNDA 193 MCDV V+ PHKPD+ENY+YFAINLIT+++PEPSP YL+ LS+R PE+EY+GP+GHL+DA Sbjct: 1 MCDVQVFAPHKPDFENYYYFAINLITRVIPEPSPATYLQGLSQRIPELEYLGPVGHLDDA 60 Query: 194 VQVRVKKSEIFDLIGLKKGFASINGVESVEIQEPKRRFKK 313 VQVRVKKSE D+ GL GF +I GVES E+Q PK R ++ Sbjct: 61 VQVRVKKSEEIDIDGLIDGFETIKGVESAELQSPKFRNRR 100