BLASTX nr result
ID: Ophiopogon26_contig00054460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054460 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX57091.1| hypothetical protein RirG_210360 [Rhizophagus irr... 210 2e-66 >gb|EXX57091.1| hypothetical protein RirG_210360 [Rhizophagus irregularis DAOM 197198w] dbj|GBC12141.1| hypothetical protein RIR_0107400 [Rhizophagus irregularis DAOM 181602] gb|PKC00029.1| hypothetical protein RhiirA5_365960 [Rhizophagus irregularis] gb|PKC62826.1| hypothetical protein RhiirA1_423422 [Rhizophagus irregularis] gb|PKK72557.1| hypothetical protein RhiirC2_742454 [Rhizophagus irregularis] gb|PKY19169.1| hypothetical protein RhiirB3_406496 [Rhizophagus irregularis] gb|PKY49846.1| hypothetical protein RhiirA4_405883 [Rhizophagus irregularis] gb|PKY50822.1| hypothetical protein RhiirA4_406899 [Rhizophagus irregularis] gb|POG79755.1| hypothetical protein GLOIN_2v1522977 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 246 Score = 210 bits (534), Expect = 2e-66 Identities = 103/105 (98%), Positives = 104/105 (99%) Frame = -3 Query: 364 SPPHFKTPSRIVPTNFGSEIKLKLMSSEDKALRLSNMKEQHMKFRPTISSGLNPIRRCEL 185 SPPHFKTPSRIVPTN+GSEIKLKLMSSEDKALRLSNMKEQHMKFRPTISS LNPIRRCEL Sbjct: 142 SPPHFKTPSRIVPTNYGSEIKLKLMSSEDKALRLSNMKEQHMKFRPTISSRLNPIRRCEL 201 Query: 184 GQRSSVGVLSSRYLADVKMDIGYNEDQRKNIIWAAGNRNEHYSQA 50 GQRSSVGVLSSRYLADVKMDIGYNEDQRKNIIWAAGNRNEHYSQA Sbjct: 202 GQRSSVGVLSSRYLADVKMDIGYNEDQRKNIIWAAGNRNEHYSQA 246