BLASTX nr result
ID: Ophiopogon26_contig00054377
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054377 (633 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY55233.1| hypothetical protein RhiirA4_474555 [Rhizophagus ... 54 3e-06 >gb|PKY55233.1| hypothetical protein RhiirA4_474555 [Rhizophagus irregularis] Length = 68 Score = 53.5 bits (127), Expect = 3e-06 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +3 Query: 303 MPSTDALETIPEESSSEAPEVLYWIKKWILINKDEDYTEVQVQPNTSSK 449 MPSTDALETIPEESSS+ + + I + DED TEVQVQPNTS + Sbjct: 1 MPSTDALETIPEESSSQDGGTVMDQEMDINKDVDEDNTEVQVQPNTSGR 49