BLASTX nr result
ID: Ophiopogon26_contig00054371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054371 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC57995.1| hypothetical protein RhiirA1_68169 [Rhizophagus i... 58 6e-16 >gb|PKC57995.1| hypothetical protein RhiirA1_68169 [Rhizophagus irregularis] gb|PKY30369.1| hypothetical protein RhiirB3_70245 [Rhizophagus irregularis] Length = 150 Score = 57.8 bits (138), Expect(2) = 6e-16 Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Frame = -3 Query: 140 ENNWIDRVGGKIGLLR*FL---SRIKPSVFFFGNIVYRENVDRKNSNII 3 ENNWI RVGG IGLL + FGNIVYRENVDRKNSNII Sbjct: 94 ENNWIGRVGGNIGLLEVISFENQTERNQCILFGNIVYRENVDRKNSNII 142 Score = 53.9 bits (128), Expect(2) = 6e-16 Identities = 35/55 (63%), Positives = 38/55 (69%), Gaps = 3/55 (5%) Frame = -1 Query: 346 RAFMNAVKISKIKYHLIPKITYRILLTNRANLSITKIKTKLN---FLESRYGSRE 191 +AFMNAVKISKIKYHLIPK ++ N TKIKTKLN LESRYGS E Sbjct: 18 KAFMNAVKISKIKYHLIPKSRVVFGVSVGYN---TKIKTKLNPQTDLESRYGSIE 69