BLASTX nr result
ID: Ophiopogon26_contig00054315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054315 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX71483.1| hypothetical protein RirG_078220 [Rhizophagus irr... 70 1e-11 gb|EXX71481.1| hypothetical protein RirG_078220 [Rhizophagus irr... 70 4e-11 dbj|GBC21279.1| related to msl5-branch point bridging protein [R... 70 4e-11 gb|PKY41265.1| hypothetical protein RhiirA4_454807 [Rhizophagus ... 67 4e-10 >gb|EXX71483.1| hypothetical protein RirG_078220 [Rhizophagus irregularis DAOM 197198w] gb|EXX71484.1| hypothetical protein RirG_078220 [Rhizophagus irregularis DAOM 197198w] Length = 174 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 395 GVVSRFADAIKPRIKRNIPTSHVANLPDSKSTPTIKE 285 GVVSRFADAIKPR KRNIPTSHVANLPD+K TPT+KE Sbjct: 131 GVVSRFADAIKPRNKRNIPTSHVANLPDTKYTPTLKE 167 >gb|EXX71481.1| hypothetical protein RirG_078220 [Rhizophagus irregularis DAOM 197198w] gb|EXX71482.1| hypothetical protein RirG_078220 [Rhizophagus irregularis DAOM 197198w] Length = 232 Score = 69.7 bits (169), Expect = 4e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 395 GVVSRFADAIKPRIKRNIPTSHVANLPDSKSTPTIKE 285 GVVSRFADAIKPR KRNIPTSHVANLPD+K TPT+KE Sbjct: 189 GVVSRFADAIKPRNKRNIPTSHVANLPDTKYTPTLKE 225 >dbj|GBC21279.1| related to msl5-branch point bridging protein [Rhizophagus irregularis DAOM 181602] gb|PKC12938.1| hypothetical protein RhiirA5_372674 [Rhizophagus irregularis] gb|PKC67854.1| hypothetical protein RhiirA1_417616 [Rhizophagus irregularis] gb|PKK75254.1| hypothetical protein RhiirC2_708262 [Rhizophagus irregularis] gb|PKY19053.1| hypothetical protein RhiirB3_406378 [Rhizophagus irregularis] gb|POG64198.1| hypothetical protein GLOIN_2v1783166 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 232 Score = 69.7 bits (169), Expect = 4e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 395 GVVSRFADAIKPRIKRNIPTSHVANLPDSKSTPTIKE 285 GVVSRFADAIKPR KRNIPTSHVANLPD+K TPT+KE Sbjct: 189 GVVSRFADAIKPRNKRNIPTSHVANLPDTKYTPTLKE 225 >gb|PKY41265.1| hypothetical protein RhiirA4_454807 [Rhizophagus irregularis] Length = 226 Score = 66.6 bits (161), Expect = 4e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -3 Query: 395 GVVSRFADAIKPRIKRNIPTSHVANLPDSKSTPTIKE 285 GVVSRFADAIKPR KR+IPTSHVAN+PD+K TPT+KE Sbjct: 189 GVVSRFADAIKPRNKRDIPTSHVANVPDTKYTPTLKE 225