BLASTX nr result
ID: Ophiopogon26_contig00054310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054310 (552 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC30672.1| hypothetical protein RIR_1615100 [Rhizophagus ir... 60 2e-11 >dbj|GBC30672.1| hypothetical protein RIR_1615100 [Rhizophagus irregularis DAOM 181602] gb|POG74867.1| hypothetical protein GLOIN_2v1572223 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 105 Score = 60.5 bits (145), Expect(2) = 2e-11 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 400 KSRKESMNFKISFMPRKAIGTCNPKEYSKKSN 495 K +ESMNFKISFMPRKAIG CNPKEYSKKSN Sbjct: 19 KPIEESMNFKISFMPRKAIGICNPKEYSKKSN 50 Score = 36.2 bits (82), Expect(2) = 2e-11 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = +2 Query: 326 MISNHKILKSKAKNRIDKNLKPL 394 MISNHKILKSKA+NRID +KP+ Sbjct: 1 MISNHKILKSKAENRID--VKPI 21