BLASTX nr result
ID: Ophiopogon26_contig00054276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054276 (850 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC03940.1| hypothetical protein RhiirA5_362806 [Rhizophagus ... 130 8e-35 gb|EXX69497.1| hypothetical protein RirG_095580 [Rhizophagus irr... 130 2e-30 >gb|PKC03940.1| hypothetical protein RhiirA5_362806 [Rhizophagus irregularis] gb|PKY17068.1| hypothetical protein RhiirB3_403775 [Rhizophagus irregularis] Length = 94 Score = 130 bits (327), Expect = 8e-35 Identities = 64/64 (100%), Positives = 64/64 (100%) Frame = +3 Query: 51 PGRGTSPIPPHNTSMLATPTRLSKPSTRTSISKLPASSRMVPSKLATPSGQPVSGLRKPK 230 PGRGTSPIPPHNTSMLATPTRLSKPSTRTSISKLPASSRMVPSKLATPSGQPVSGLRKPK Sbjct: 31 PGRGTSPIPPHNTSMLATPTRLSKPSTRTSISKLPASSRMVPSKLATPSGQPVSGLRKPK 90 Query: 231 MTKE 242 MTKE Sbjct: 91 MTKE 94 >gb|EXX69497.1| hypothetical protein RirG_095580 [Rhizophagus irregularis DAOM 197198w] dbj|GBC34582.1| hypothetical protein RIR_1931100 [Rhizophagus irregularis DAOM 181602] Length = 941 Score = 130 bits (327), Expect = 2e-30 Identities = 64/64 (100%), Positives = 64/64 (100%) Frame = +3 Query: 51 PGRGTSPIPPHNTSMLATPTRLSKPSTRTSISKLPASSRMVPSKLATPSGQPVSGLRKPK 230 PGRGTSPIPPHNTSMLATPTRLSKPSTRTSISKLPASSRMVPSKLATPSGQPVSGLRKPK Sbjct: 878 PGRGTSPIPPHNTSMLATPTRLSKPSTRTSISKLPASSRMVPSKLATPSGQPVSGLRKPK 937 Query: 231 MTKE 242 MTKE Sbjct: 938 MTKE 941