BLASTX nr result
ID: Ophiopogon26_contig00054266
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054266 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY47781.1| hypothetical protein RhiirA4_544199 [Rhizophagus ... 70 2e-11 gb|PKC14599.1| hypothetical protein RhiirA5_452710 [Rhizophagus ... 67 3e-10 gb|PKY21226.1| hypothetical protein RhiirB3_499894 [Rhizophagus ... 67 3e-10 gb|PKK69373.1| hypothetical protein RhiirC2_712710 [Rhizophagus ... 67 3e-10 gb|EXX79131.1| hypothetical protein RirG_008610 [Rhizophagus irr... 67 3e-10 >gb|PKY47781.1| hypothetical protein RhiirA4_544199 [Rhizophagus irregularis] Length = 663 Score = 70.5 bits (171), Expect = 2e-11 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +1 Query: 58 IKRDGRFYSFETIKRSLFTKREELLKVDVSTNVEVNTPIKE 180 IKRDGRFY FE IKRSL+TKREE LK+DVSTNVEVNTPIKE Sbjct: 6 IKRDGRFYLFENIKRSLYTKREE-LKLDVSTNVEVNTPIKE 45 >gb|PKC14599.1| hypothetical protein RhiirA5_452710 [Rhizophagus irregularis] gb|PKC66883.1| hypothetical protein RhiirA1_511064 [Rhizophagus irregularis] Length = 607 Score = 67.4 bits (163), Expect = 3e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 58 IKRDGRFYSFETIKRSLFTKREELLKVDVSTNVEVNTPIKE 180 IKRDGRFY FE IK SL+TKREE LK+DVSTNVEVNTPIKE Sbjct: 6 IKRDGRFYLFENIKISLYTKREE-LKLDVSTNVEVNTPIKE 45 >gb|PKY21226.1| hypothetical protein RhiirB3_499894 [Rhizophagus irregularis] Length = 629 Score = 67.4 bits (163), Expect = 3e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 58 IKRDGRFYSFETIKRSLFTKREELLKVDVSTNVEVNTPIKE 180 IKRDGRFY FE IK SL+TKREE LK+DVSTNVEVNTPIKE Sbjct: 6 IKRDGRFYLFENIKISLYTKREE-LKLDVSTNVEVNTPIKE 45 >gb|PKK69373.1| hypothetical protein RhiirC2_712710 [Rhizophagus irregularis] Length = 637 Score = 67.4 bits (163), Expect = 3e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 58 IKRDGRFYSFETIKRSLFTKREELLKVDVSTNVEVNTPIKE 180 IKRDGRFY FE IK SL+TKREE LK+DVSTNVEVNTPIKE Sbjct: 6 IKRDGRFYLFENIKISLYTKREE-LKLDVSTNVEVNTPIKE 45 >gb|EXX79131.1| hypothetical protein RirG_008610 [Rhizophagus irregularis DAOM 197198w] dbj|GBC50374.1| trichohyalin-like [Rhizophagus irregularis DAOM 181602] Length = 647 Score = 67.4 bits (163), Expect = 3e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 58 IKRDGRFYSFETIKRSLFTKREELLKVDVSTNVEVNTPIKE 180 IKRDGRFY FE IK SL+TKREE LK+DVSTNVEVNTPIKE Sbjct: 6 IKRDGRFYLFENIKISLYTKREE-LKLDVSTNVEVNTPIKE 45