BLASTX nr result
ID: Ophiopogon26_contig00054245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054245 (533 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020274926.1| microtubule-associated protein RP/EB family ... 66 2e-09 ref|XP_020241609.1| microtubule-associated protein RP/EB family ... 66 2e-09 ref|XP_010918422.1| PREDICTED: microtubule-associated protein RP... 60 1e-07 ref|XP_008806524.1| PREDICTED: microtubule-associated protein RP... 60 1e-07 >ref|XP_020274926.1| microtubule-associated protein RP/EB family member 1C-like [Asparagus officinalis] ref|XP_020274927.1| microtubule-associated protein RP/EB family member 1C-like [Asparagus officinalis] ref|XP_020274928.1| microtubule-associated protein RP/EB family member 1C-like [Asparagus officinalis] gb|ONK64015.1| uncharacterized protein A4U43_C07F21230 [Asparagus officinalis] Length = 328 Score = 65.9 bits (159), Expect = 2e-09 Identities = 33/44 (75%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -2 Query: 532 KQET-QKRKDISTLEVDLVASSKSTPRQRLSDISNVQDDSPLMN 404 KQET QKRKDIS ++D +ASSKSTPRQ+LSDISN+ DDSPL+N Sbjct: 284 KQETTQKRKDISNFDLDTIASSKSTPRQKLSDISNLVDDSPLVN 327 >ref|XP_020241609.1| microtubule-associated protein RP/EB family member 1C-like [Asparagus officinalis] gb|ONK79712.1| uncharacterized protein A4U43_C01F9270 [Asparagus officinalis] Length = 330 Score = 65.9 bits (159), Expect = 2e-09 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -2 Query: 532 KQETQKRKDISTLEVDLVASSKSTPRQRLSDISNVQDDSPLMNC*KF 392 KQETQKRKDIS EV++ +SKSTPRQRLSDISN QD SPL++ F Sbjct: 284 KQETQKRKDISNFEVEVEENSKSTPRQRLSDISNFQDGSPLVDAETF 330 >ref|XP_010918422.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Elaeis guineensis] Length = 324 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -2 Query: 532 KQETQKRKDISTLEVDLVASSKSTPRQRLSDISNVQ-DDSPLMNC 401 KQETQKRK+IST+EVD+ ASS +PRQRLSDIS+V SPL NC Sbjct: 280 KQETQKRKNISTIEVDMAASSTLSPRQRLSDISDVHYCGSPLTNC 324 >ref|XP_008806524.1| PREDICTED: microtubule-associated protein RP/EB family member 1C [Phoenix dactylifera] Length = 324 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -2 Query: 532 KQETQKRKDISTLEVDLVASSKSTPRQRLSDISNVQ-DDSPLMNC 401 KQETQKRK+IST+EVD+ ASS +PRQRLSDIS+V SPL NC Sbjct: 280 KQETQKRKNISTIEVDMAASSTLSPRQRLSDISDVHYCGSPLTNC 324