BLASTX nr result
ID: Ophiopogon26_contig00054195
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054195 (646 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC41542.1| hypothetical protein RIR_2491300 [Rhizophagus ir... 73 2e-13 >dbj|GBC41542.1| hypothetical protein RIR_2491300 [Rhizophagus irregularis DAOM 181602] Length = 92 Score = 73.2 bits (178), Expect = 2e-13 Identities = 40/50 (80%), Positives = 41/50 (82%) Frame = -3 Query: 281 MLNTINTRILMRFLKTMLPYTRYTLSSQIVIIHWARAVQELQISSAHAIQ 132 MLNTINTRIL+RFLKT L TRYTLSSQIVIIHWARAVQE S AIQ Sbjct: 1 MLNTINTRILVRFLKTTLSSTRYTLSSQIVIIHWARAVQEF-CSKPQAIQ 49