BLASTX nr result
ID: Ophiopogon26_contig00054148
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054148 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFA45286.1| hypothetical protein EW35_3259 [Staphylococcus au... 55 1e-07 >gb|KFA45286.1| hypothetical protein EW35_3259 [Staphylococcus aureus] gb|KFA45291.1| hypothetical protein EW35_3208 [Staphylococcus aureus] Length = 53 Score = 54.7 bits (130), Expect = 1e-07 Identities = 24/52 (46%), Positives = 33/52 (63%) Frame = +3 Query: 168 PSNSAYGLEQATMQPAELSFSVPAYINAVLGGAGILTCFPSPTPLGLDLGID 323 P+ Y L+ + + LS+ VP I ++GG GI TC+PSPTP+GL LG D Sbjct: 2 PNTQPYCLDVQSNRTLRLSYCVPPSIKTIIGGTGISTCYPSPTPVGLSLGPD 53