BLASTX nr result
ID: Ophiopogon26_contig00054145
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054145 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX54871.1| hypothetical protein RirG_230530 [Rhizophagus irr... 102 3e-25 gb|POG64329.1| hypothetical protein GLOIN_2v1676365 [Rhizophagus... 102 5e-25 gb|PKK71308.1| Presenilin-domain-containing protein [Rhizophagus... 91 7e-19 gb|PKC15221.1| Presenilin-domain-containing protein [Rhizophagus... 91 7e-19 gb|PKY39189.1| Presenilin-domain-containing protein [Rhizophagus... 91 7e-19 >gb|EXX54871.1| hypothetical protein RirG_230530 [Rhizophagus irregularis DAOM 197198w] dbj|GBC54114.1| disease resistance protein aig2 [Rhizophagus irregularis DAOM 181602] gb|PKY20846.1| hypothetical protein RhiirB3_331553 [Rhizophagus irregularis] Length = 141 Score = 102 bits (253), Expect = 3e-25 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = +2 Query: 89 QYERKKIKVYIENEETPIEAITYVWNDSPRLLDEKDWNSEEFEWSKFTDY 238 QYERKKIKVYIENE TPIEAITYVW DSP LLDEKDWNSEEFEWSKF+DY Sbjct: 92 QYERKKIKVYIENEGTPIEAITYVWKDSPDLLDEKDWNSEEFEWSKFSDY 141 >gb|POG64329.1| hypothetical protein GLOIN_2v1676365 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 155 Score = 102 bits (253), Expect = 5e-25 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = +2 Query: 89 QYERKKIKVYIENEETPIEAITYVWNDSPRLLDEKDWNSEEFEWSKFTDY 238 QYERKKIKVYIENE TPIEAITYVW DSP LLDEKDWNSEEFEWSKF+DY Sbjct: 106 QYERKKIKVYIENEGTPIEAITYVWKDSPDLLDEKDWNSEEFEWSKFSDY 155 >gb|PKK71308.1| Presenilin-domain-containing protein [Rhizophagus irregularis] Length = 716 Score = 91.3 bits (225), Expect = 7e-19 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +2 Query: 89 QYERKKIKVYIENEETPIEAITYVWNDSPRLLDEKDWNSEEFEWS 223 QYERKKIKVYIENE TPIEAITYVW DSP LLDEKDWNSEEFEW+ Sbjct: 92 QYERKKIKVYIENEGTPIEAITYVWKDSPDLLDEKDWNSEEFEWN 136 >gb|PKC15221.1| Presenilin-domain-containing protein [Rhizophagus irregularis] gb|PKC65264.1| Presenilin-domain-containing protein [Rhizophagus irregularis] Length = 716 Score = 91.3 bits (225), Expect = 7e-19 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +2 Query: 89 QYERKKIKVYIENEETPIEAITYVWNDSPRLLDEKDWNSEEFEWS 223 QYERKKIKVYIENE TPIEAITYVW DSP LLDEKDWNSEEFEW+ Sbjct: 92 QYERKKIKVYIENEGTPIEAITYVWKDSPDLLDEKDWNSEEFEWN 136 >gb|PKY39189.1| Presenilin-domain-containing protein [Rhizophagus irregularis] Length = 717 Score = 91.3 bits (225), Expect = 7e-19 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +2 Query: 89 QYERKKIKVYIENEETPIEAITYVWNDSPRLLDEKDWNSEEFEWS 223 QYERKKIKVYIENE TPIEAITYVW DSP LLDEKDWNSEEFEW+ Sbjct: 92 QYERKKIKVYIENEGTPIEAITYVWKDSPDLLDEKDWNSEEFEWN 136