BLASTX nr result
ID: Ophiopogon26_contig00054106
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054106 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX77837.1| hypothetical protein RirG_020180 [Rhizophagus irr... 66 2e-11 gb|PKK64021.1| hypothetical protein RhiirC2_854609 [Rhizophagus ... 65 8e-10 gb|PKY42372.1| hypothetical protein RhiirA4_456159 [Rhizophagus ... 65 2e-09 gb|PKY50556.1| hypothetical protein RhiirA4_467091 [Rhizophagus ... 65 3e-09 gb|POG63773.1| hypothetical protein GLOIN_2v1783684 [Rhizophagus... 64 5e-09 dbj|GBC44471.1| Tis13_8612: PROVISIONAL [Rhizophagus irregularis... 62 1e-08 >gb|EXX77837.1| hypothetical protein RirG_020180 [Rhizophagus irregularis DAOM 197198w] Length = 81 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +1 Query: 301 NELRVSHVKSLVFAEISDKLKSRNINNYDSLKLWKVDGAKVD 426 ++++VSH+KSLVF EIS+KLKS NINN+ SLKLWKVDG KV+ Sbjct: 24 DDIQVSHIKSLVFNEISEKLKSLNINNFASLKLWKVDGKKVE 65 >gb|PKK64021.1| hypothetical protein RhiirC2_854609 [Rhizophagus irregularis] Length = 248 Score = 65.1 bits (157), Expect = 8e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +1 Query: 301 NELRVSHVKSLVFAEISDKLKSRNINNYDSLKLWKVDGAK 420 ++++VSH+KSLVF EISDKLKS NINN+ SLKLWKVDG K Sbjct: 24 DDIQVSHIKSLVFNEISDKLKSLNINNFASLKLWKVDGKK 63 >gb|PKY42372.1| hypothetical protein RhiirA4_456159 [Rhizophagus irregularis] Length = 364 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +1 Query: 301 NELRVSHVKSLVFAEISDKLKSRNINNYDSLKLWKVDGAK 420 ++++VSH+KSLVF EISDKLKS NINN+ SLKLWKVDG K Sbjct: 24 DDIQVSHIKSLVFNEISDKLKSLNINNFASLKLWKVDGKK 63 >gb|PKY50556.1| hypothetical protein RhiirA4_467091 [Rhizophagus irregularis] Length = 608 Score = 64.7 bits (156), Expect = 3e-09 Identities = 39/86 (45%), Positives = 49/86 (56%) Frame = +1 Query: 169 MSFSLNCLLQDEKPDDSFLVXXXXXXXXXXXXXXXXXXXXXXXFNELRVSHVKSLVFAEI 348 M FSLNCLL E+ ++SF V ++++ VSH+KSLVF Sbjct: 1 MYFSLNCLLLGEEFNNSFSVNIGATSEN---------------YDDIEVSHIKSLVFDRK 45 Query: 349 SDKLKSRNINNYDSLKLWKVDGAKVD 426 S KLKS NINN DSL+LWKVD KV+ Sbjct: 46 SYKLKSLNINNSDSLELWKVDSKKVE 71 >gb|POG63773.1| hypothetical protein GLOIN_2v1783684 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 313 Score = 63.5 bits (153), Expect = 5e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = +1 Query: 301 NELRVSHVKSLVFAEISDKLKSRNINNYDSLKLWKVDGAK 420 ++++VSH+KSLVF EIS+KLKS NINN+ SLKLWKVDG K Sbjct: 24 DDIQVSHIKSLVFNEISEKLKSLNINNFASLKLWKVDGKK 63 >dbj|GBC44471.1| Tis13_8612: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 244 Score = 62.0 bits (149), Expect = 1e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +1 Query: 301 NELRVSHVKSLVFAEISDKLKSRNINNYDSLKLWKVDG 414 ++++VSH+KSLVF EIS+KLKS NINN+ SLKLWKVDG Sbjct: 24 DDIQVSHIKSLVFNEISEKLKSLNINNFASLKLWKVDG 61