BLASTX nr result
ID: Ophiopogon26_contig00054038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054038 (479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC44052.1| Tis13_26542: PROVISIONAL [Rhizophagus irregulari... 68 6e-12 gb|PKK64701.1| hypothetical protein RhiirC2_716090 [Rhizophagus ... 58 2e-07 >dbj|GBC44052.1| Tis13_26542: PROVISIONAL [Rhizophagus irregularis DAOM 181602] Length = 87 Score = 67.8 bits (164), Expect = 6e-12 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -1 Query: 356 WNPTDEETKFTFQSGWKC*L*HRLCFQKFY*VRTQDSSWWILDKYSSLSPSFKLLIPKDT 177 WNPTDEETKF + + L + VRTQD WWIL+KYSSLSPSFKLLIPKDT Sbjct: 16 WNPTDEETKF---------IRNILLSNQ---VRTQDLPWWILEKYSSLSPSFKLLIPKDT 63 >gb|PKK64701.1| hypothetical protein RhiirC2_716090 [Rhizophagus irregularis] Length = 163 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 273 ILLGQDSGLFVVDSGQIQLTVPIFQTVNPKGYIT 172 +L QDSGL +VDSG+IQLTVPIFQTVNPKGYI+ Sbjct: 101 LLSNQDSGLSMVDSGKIQLTVPIFQTVNPKGYIS 134