BLASTX nr result
ID: Ophiopogon26_contig00054037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054037 (519 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX76006.1| hypothetical protein RirG_036980 [Rhizophagus irr... 60 9e-09 >gb|EXX76006.1| hypothetical protein RirG_036980 [Rhizophagus irregularis DAOM 197198w] dbj|GBC54290.1| JEMT01012331.1_cds_EXX76006.1_4029 [Rhizophagus irregularis DAOM 181602] Length = 94 Score = 60.1 bits (144), Expect = 9e-09 Identities = 30/73 (41%), Positives = 42/73 (57%) Frame = -2 Query: 368 KKHPYKSASITLVVALSIYQRXXXXXXXXLIGYVIVGDERQIVIDYCKEHSLELKLIEPP 189 + +P K IT+ + LS QR LI Y IVG++RQI ++Y H LE++ IE Sbjct: 12 ENNPLKVTIITITLILSYNQRRLLRDRIVLISYAIVGNDRQIALNYLLRHGLEIREIETI 71 Query: 188 QPTSDGWFWWLRW 150 + S WFWW+RW Sbjct: 72 KDKS--WFWWVRW 82