BLASTX nr result
ID: Ophiopogon26_contig00054011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00054011 (702 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG59014.1| hypothetical protein GLOIN_2v1725857 [Rhizophagus... 77 8e-13 dbj|GBC41444.1| fasciclin-domain-containing protein [Rhizophagus... 77 1e-12 gb|PKK76955.1| FAS1 domain-containing protein [Rhizophagus irreg... 77 1e-12 gb|PKC03758.1| FAS1 domain-containing protein [Rhizophagus irreg... 77 1e-12 gb|PKY49376.1| FAS1 domain-containing protein [Rhizophagus irreg... 76 2e-12 >gb|POG59014.1| hypothetical protein GLOIN_2v1725857 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 393 Score = 77.4 bits (189), Expect = 8e-13 Identities = 37/71 (52%), Positives = 53/71 (74%), Gaps = 3/71 (4%) Frame = +3 Query: 252 VPTESSGS--LNEGKTDGGYNPYSKHYT-DKKLIIGTVMGGVCGVIVVTLFTCMLYKWYK 422 +P + SG ++ T+G N Y+ T DKKLI+GTV+GG+CG IV++LF+CMLYKWY+ Sbjct: 313 LPLDGSGGNVVSNNSTNGFDNGYNVQGTSDKKLIVGTVLGGICGGIVISLFSCMLYKWYR 372 Query: 423 ARKNSRTTTIS 455 A+KNS++ T S Sbjct: 373 AQKNSKSVTTS 383 >dbj|GBC41444.1| fasciclin-domain-containing protein [Rhizophagus irregularis DAOM 181602] Length = 466 Score = 77.4 bits (189), Expect = 1e-12 Identities = 37/71 (52%), Positives = 53/71 (74%), Gaps = 3/71 (4%) Frame = +3 Query: 252 VPTESSGS--LNEGKTDGGYNPYSKHYT-DKKLIIGTVMGGVCGVIVVTLFTCMLYKWYK 422 +P + SG ++ T+G N Y+ T DKKLI+GTV+GG+CG IV++LF+CMLYKWY+ Sbjct: 313 LPLDGSGGNVVSNNSTNGFDNGYNVQGTSDKKLIVGTVLGGICGGIVISLFSCMLYKWYR 372 Query: 423 ARKNSRTTTIS 455 A+KNS++ T S Sbjct: 373 AQKNSKSVTTS 383 >gb|PKK76955.1| FAS1 domain-containing protein [Rhizophagus irregularis] Length = 394 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/71 (52%), Positives = 53/71 (74%), Gaps = 3/71 (4%) Frame = +3 Query: 252 VPTESSGS--LNEGKTDGGYNPYSKHYT-DKKLIIGTVMGGVCGVIVVTLFTCMLYKWYK 422 +P + SG ++ T+G N Y+ T DKKLI+GTV+GG+CG IV++LF+CMLYKWY+ Sbjct: 313 LPLDGSGGNVVSNNSTNGFDNGYNVQGTSDKKLIVGTVLGGICGGIVISLFSCMLYKWYR 372 Query: 423 ARKNSRTTTIS 455 A+KNS++ T S Sbjct: 373 AQKNSKSVTSS 383 >gb|PKC03758.1| FAS1 domain-containing protein [Rhizophagus irregularis] gb|PKC57520.1| FAS1 domain-containing protein [Rhizophagus irregularis] gb|PKY27264.1| FAS1 domain-containing protein [Rhizophagus irregularis] Length = 394 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/71 (52%), Positives = 53/71 (74%), Gaps = 3/71 (4%) Frame = +3 Query: 252 VPTESSGS--LNEGKTDGGYNPYSKHYT-DKKLIIGTVMGGVCGVIVVTLFTCMLYKWYK 422 +P + SG ++ T+G N Y+ T DKKLI+GTV+GG+CG IV++LF+CMLYKWY+ Sbjct: 313 LPLDGSGGNVVSNNSTNGFDNGYNVQGTSDKKLIVGTVLGGICGGIVISLFSCMLYKWYR 372 Query: 423 ARKNSRTTTIS 455 A+KNS++ T S Sbjct: 373 AQKNSKSVTSS 383 >gb|PKY49376.1| FAS1 domain-containing protein [Rhizophagus irregularis] Length = 390 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/69 (52%), Positives = 52/69 (75%), Gaps = 3/69 (4%) Frame = +3 Query: 252 VPTESSGS--LNEGKTDGGYNPYSKHYT-DKKLIIGTVMGGVCGVIVVTLFTCMLYKWYK 422 +P + SG ++ T+G N Y+ T DKKLI+GTV+GG+CG IV++LF+CMLYKWY+ Sbjct: 313 LPLDGSGGNVVSNNSTNGFDNGYNVQGTRDKKLIVGTVLGGICGGIVISLFSCMLYKWYR 372 Query: 423 ARKNSRTTT 449 A+KNS++ T Sbjct: 373 AQKNSKSVT 381