BLASTX nr result
ID: Ophiopogon26_contig00053921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053921 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC55462.1| hypothetical protein RhiirA1_117619 [Rhizophagus ... 92 1e-19 >gb|PKC55462.1| hypothetical protein RhiirA1_117619 [Rhizophagus irregularis] gb|PKY29496.1| hypothetical protein RhiirB3_53879 [Rhizophagus irregularis] Length = 387 Score = 92.4 bits (228), Expect = 1e-19 Identities = 51/72 (70%), Positives = 54/72 (75%), Gaps = 3/72 (4%) Frame = +3 Query: 120 MSVNRIHLMNSIDMYGVAGEQNFQKITSRGYLKAFDETSEAEVNLSKKSRTDDGNNPLIV 299 MSVNR HLMNS+DMYGVAGEQN+QKITSRGYLKAF ETSEAE+ SK NP IV Sbjct: 1 MSVNRTHLMNSMDMYGVAGEQNYQKITSRGYLKAFGETSEAELGSSK--------NPFIV 52 Query: 300 SEHEM---TNQD 326 SEH M NQD Sbjct: 53 SEHGMDSINNQD 64