BLASTX nr result
ID: Ophiopogon26_contig00053891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053891 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC56217.1| hypothetical protein RhiirA1_103318 [Rhizophagus ... 60 4e-08 gb|PKK68741.1| hypothetical protein RhiirC2_529015 [Rhizophagus ... 60 5e-08 gb|PKB96820.1| hypothetical protein RhiirA5_134441 [Rhizophagus ... 60 7e-08 gb|POG72914.1| hypothetical protein GLOIN_2v1840269 [Rhizophagus... 58 8e-07 gb|PKK61423.1| hypothetical protein RhiirC2_760725 [Rhizophagus ... 56 3e-06 gb|EXX55078.1| hypothetical protein RirG_228650 [Rhizophagus irr... 56 4e-06 gb|PKC56667.1| hypothetical protein RhiirA1_473670, partial [Rhi... 55 9e-06 >gb|PKC56217.1| hypothetical protein RhiirA1_103318 [Rhizophagus irregularis] Length = 208 Score = 60.5 bits (145), Expect = 4e-08 Identities = 34/41 (82%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 474 SDDDFMPIRQPKRKKNLSL-PKNKESVGSAVSKKAKTTKDT 355 SDDDFMP RQPKRKK LSL KNKESVGS +KKAKTTKDT Sbjct: 52 SDDDFMPARQPKRKKPLSLSKKNKESVGS--TKKAKTTKDT 90 >gb|PKK68741.1| hypothetical protein RhiirC2_529015 [Rhizophagus irregularis] Length = 213 Score = 60.5 bits (145), Expect = 5e-08 Identities = 34/41 (82%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 474 SDDDFMPIRQPKRKKNLSL-PKNKESVGSAVSKKAKTTKDT 355 SDDDFMP RQPKRKK LSL KNKESVGS +KKAKTTKDT Sbjct: 52 SDDDFMPARQPKRKKPLSLSKKNKESVGS--TKKAKTTKDT 90 >gb|PKB96820.1| hypothetical protein RhiirA5_134441 [Rhizophagus irregularis] gb|PKY34453.1| hypothetical protein RhiirB3_475990 [Rhizophagus irregularis] Length = 247 Score = 60.5 bits (145), Expect = 7e-08 Identities = 34/41 (82%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -2 Query: 474 SDDDFMPIRQPKRKKNLSL-PKNKESVGSAVSKKAKTTKDT 355 SDDDFMP RQPKRKK LSL KNKESVGS +KKAKTTKDT Sbjct: 52 SDDDFMPARQPKRKKPLSLSKKNKESVGS--TKKAKTTKDT 90 >gb|POG72914.1| hypothetical protein GLOIN_2v1840269 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 571 Score = 58.2 bits (139), Expect = 8e-07 Identities = 33/41 (80%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 474 SDDDFMPIRQPKRKKNLSL-PKNKESVGSAVSKKAKTTKDT 355 SDDDFMP RQPKRKK LSL KNKESVGS +KKAKT KDT Sbjct: 423 SDDDFMPARQPKRKKPLSLSKKNKESVGS--TKKAKTMKDT 461 >gb|PKK61423.1| hypothetical protein RhiirC2_760725 [Rhizophagus irregularis] Length = 266 Score = 56.2 bits (134), Expect = 3e-06 Identities = 33/41 (80%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 474 SDDDFMPIRQPKRKKNLSLP-KNKESVGSAVSKKAKTTKDT 355 SD DFMP+RQ KRKK LSLP KNKESV SA KKAKTTKDT Sbjct: 127 SDYDFMPVRQLKRKKQLSLPKKNKESVYSA--KKAKTTKDT 165 >gb|EXX55078.1| hypothetical protein RirG_228650 [Rhizophagus irregularis DAOM 197198w] gb|EXX55079.1| hypothetical protein RirG_228650 [Rhizophagus irregularis DAOM 197198w] dbj|GBC20319.1| hypothetical protein RIR_0772300 [Rhizophagus irregularis DAOM 181602] gb|POG74055.1| hypothetical protein GLOIN_2v1580400 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 585 Score = 56.2 bits (134), Expect = 4e-06 Identities = 33/41 (80%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -2 Query: 474 SDDDFMPIRQPKRKKNLSLP-KNKESVGSAVSKKAKTTKDT 355 SD DFMP+RQ KRKK LSLP KNKESV SA KKAKTTKDT Sbjct: 127 SDYDFMPVRQLKRKKQLSLPKKNKESVYSA--KKAKTTKDT 165 >gb|PKC56667.1| hypothetical protein RhiirA1_473670, partial [Rhizophagus irregularis] gb|PKY23942.1| hypothetical protein RhiirB3_438322, partial [Rhizophagus irregularis] Length = 363 Score = 55.1 bits (131), Expect = 9e-06 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -2 Query: 489 VESI*SDDDFMPIRQPKRKKNLSLP-KNKESVGSAVSKKAKTTKDT 355 +E SDDDFMP PKRKK LSLP KNKESVGSA KKAKTTKDT Sbjct: 143 LEKALSDDDFMPACIPKRKK-LSLPKKNKESVGSA--KKAKTTKDT 185