BLASTX nr result
ID: Ophiopogon26_contig00053851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053851 (670 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC16382.1| hypothetical protein RIR_0455600 [Rhizophagus ir... 91 3e-20 gb|EXX51678.1| hypothetical protein RirG_259650 [Rhizophagus irr... 52 2e-10 gb|PKC62568.1| hypothetical protein RhiirA1_464967 [Rhizophagus ... 46 1e-09 >dbj|GBC16382.1| hypothetical protein RIR_0455600 [Rhizophagus irregularis DAOM 181602] Length = 68 Score = 90.5 bits (223), Expect = 3e-20 Identities = 45/62 (72%), Positives = 46/62 (74%), Gaps = 3/62 (4%) Frame = +3 Query: 378 TSWCTTKGPPHHNLRIYIRTSR---RNSRCYILDVHIIYYIEMSQXXXXXXXXXXXDESA 548 TSWCT KGPPHHNLRIYIR +R RNSRCYILDVHIIYYIEMSQ DESA Sbjct: 7 TSWCTIKGPPHHNLRIYIRPNRAWRRNSRCYILDVHIIYYIEMSQEVYKKKKKVEYDESA 66 Query: 549 IL 554 IL Sbjct: 67 IL 68 >gb|EXX51678.1| hypothetical protein RirG_259650 [Rhizophagus irregularis DAOM 197198w] Length = 67 Score = 52.0 bits (123), Expect(2) = 2e-10 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +3 Query: 123 DAITLVSRLISLNDFSEKFEPFFKQDTK*DFRDHIKADD 239 DAITLVSRLIS NDFS+ F + K DFRDHIKADD Sbjct: 5 DAITLVSRLISPNDFSKNSNLFSNKTLKRDFRDHIKADD 43 Score = 41.6 bits (96), Expect(2) = 2e-10 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = +2 Query: 320 TRMDSEMQKYDQWGERTQH 376 TRMD EMQKYDQWGER QH Sbjct: 45 TRMDYEMQKYDQWGERIQH 63 >gb|PKC62568.1| hypothetical protein RhiirA1_464967 [Rhizophagus irregularis] gb|PKY16419.1| hypothetical protein RhiirB3_428792 [Rhizophagus irregularis] Length = 67 Score = 46.2 bits (108), Expect(2) = 1e-09 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +2 Query: 320 TRMDSEMQKYDQWGERTQH 376 TRMDSEMQKYDQWGERTQH Sbjct: 26 TRMDSEMQKYDQWGERTQH 44 Score = 44.7 bits (104), Expect(2) = 1e-09 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 367 DTTSHRGARQKGLLITISEYTYE 435 + T HRGARQKGLLITISEYTYE Sbjct: 40 ERTQHRGARQKGLLITISEYTYE 62