BLASTX nr result
ID: Ophiopogon26_contig00053810
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053810 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC18308.1| hypothetical protein RIR_0609300 [Rhizophagus ir... 68 3e-12 >dbj|GBC18308.1| hypothetical protein RIR_0609300 [Rhizophagus irregularis DAOM 181602] Length = 94 Score = 68.2 bits (165), Expect = 3e-12 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 129 TLS*CIGRNWSKRSVYPETCEICLNFGNIRNL 34 T++ CIGRNWSKRSVYPETCEICLNFGNIRNL Sbjct: 61 TMAHCIGRNWSKRSVYPETCEICLNFGNIRNL 92