BLASTX nr result
ID: Ophiopogon26_contig00053798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053798 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POG71976.1| hypothetical protein GLOIN_2v1875554 [Rhizophagus... 122 7e-33 gb|PKY50094.1| hypothetical protein RhiirA4_545710 [Rhizophagus ... 122 1e-32 gb|PKK76222.1| hypothetical protein RhiirC2_772741 [Rhizophagus ... 110 2e-28 gb|EXX52108.1| hypothetical protein RirG_255950 [Rhizophagus irr... 56 1e-07 >gb|POG71976.1| hypothetical protein GLOIN_2v1875554 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 113 Score = 122 bits (306), Expect = 7e-33 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 1/64 (1%) Frame = +1 Query: 4 FVLNLGLKKRKITKHPCYSLSNSVFVGVQLTGKSSQEI-DVISTKFSVDVSHVLKTLDYS 180 FVLNLGLKKRKITKHPCYSLSNSVFVGVQLTGKSSQEI DVISTKFSVDVSHVLKTLDYS Sbjct: 49 FVLNLGLKKRKITKHPCYSLSNSVFVGVQLTGKSSQEIEDVISTKFSVDVSHVLKTLDYS 108 Query: 181 YGNA 192 YGNA Sbjct: 109 YGNA 112 >gb|PKY50094.1| hypothetical protein RhiirA4_545710 [Rhizophagus irregularis] Length = 136 Score = 122 bits (306), Expect = 1e-32 Identities = 63/64 (98%), Positives = 63/64 (98%), Gaps = 1/64 (1%) Frame = +1 Query: 4 FVLNLGLKKRKITKHPCYSLSNSVFVGVQLTGKSSQEI-DVISTKFSVDVSHVLKTLDYS 180 FVLNLGLKKRKITKHPCYSLSNSVFVGVQLTGKSSQEI DVISTKFSVDVSHVLKTLDYS Sbjct: 72 FVLNLGLKKRKITKHPCYSLSNSVFVGVQLTGKSSQEIEDVISTKFSVDVSHVLKTLDYS 131 Query: 181 YGNA 192 YGNA Sbjct: 132 YGNA 135 >gb|PKK76222.1| hypothetical protein RhiirC2_772741 [Rhizophagus irregularis] Length = 100 Score = 110 bits (276), Expect = 2e-28 Identities = 57/58 (98%), Positives = 57/58 (98%), Gaps = 1/58 (1%) Frame = +1 Query: 22 LKKRKITKHPCYSLSNSVFVGVQLTGKSSQEI-DVISTKFSVDVSHVLKTLDYSYGNA 192 LKKRKITKHPCYSLSNSVFVGVQLTGKSSQEI DVISTKFSVDVSHVLKTLDYSYGNA Sbjct: 42 LKKRKITKHPCYSLSNSVFVGVQLTGKSSQEIEDVISTKFSVDVSHVLKTLDYSYGNA 99 >gb|EXX52108.1| hypothetical protein RirG_255950 [Rhizophagus irregularis DAOM 197198w] dbj|GBC18712.1| JEMT01029470.1_cds_EXX52108.1_27924 [Rhizophagus irregularis DAOM 181602] Length = 56 Score = 55.8 bits (133), Expect = 1e-07 Identities = 34/51 (66%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = +1 Query: 19 GLKKRKITKH-PCYSLSNSVFVGVQLTGKSSQEI-DVISTKFSVDVSHVLK 165 GLKKRK TK PC L+ SVF+G QL GKSSQEI D ISTKFSV LK Sbjct: 5 GLKKRKTTKTTPCCPLNKSVFIGGQLNGKSSQEIKDFISTKFSVGYPMFLK 55