BLASTX nr result
ID: Ophiopogon26_contig00053698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053698 (704 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC53256.1| hypothetical protein RIR_3448700 [Rhizophagus ir... 83 1e-16 >dbj|GBC53256.1| hypothetical protein RIR_3448700 [Rhizophagus irregularis DAOM 181602] Length = 115 Score = 82.8 bits (203), Expect = 1e-16 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +1 Query: 280 AENSRYGPCNPLQIPEDSVIATLTKSTNKQQEWRQYWILKLVRSIPP 420 ++NSRYG CN LQIPEDSVI TLTK TNKQQEWRQ WILKLVRSI P Sbjct: 9 SKNSRYGLCNSLQIPEDSVIVTLTKPTNKQQEWRQCWILKLVRSITP 55