BLASTX nr result
ID: Ophiopogon26_contig00053661
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053661 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC50912.1| hypothetical protein RIR_3251600 [Rhizophagus ir... 76 3e-15 >dbj|GBC50912.1| hypothetical protein RIR_3251600 [Rhizophagus irregularis DAOM 181602] Length = 85 Score = 76.3 bits (186), Expect = 3e-15 Identities = 41/80 (51%), Positives = 48/80 (60%), Gaps = 3/80 (3%) Frame = +3 Query: 249 HKFLKEFSYDSYYITLWSLSVCHSCKKKFKKCTNFATKVGSNLPKKFYLSLTSLTHFFNR 428 HKFLKEFSYDSYYITLWSLSV +K K + ++ + Y + + N Sbjct: 11 HKFLKEFSYDSYYITLWSLSVAIRARKNLK-----SVQISQRKSEAIYQKVKDIHWAINN 65 Query: 429 ---IEMKFCIKEYRRKFTHV 479 IEMKFCIKEYRRKFT V Sbjct: 66 SLMIEMKFCIKEYRRKFTQV 85