BLASTX nr result
ID: Ophiopogon26_contig00053638
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053638 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX55280.1| hypothetical protein RirG_226790 [Rhizophagus irr... 62 4e-10 gb|PKY56201.1| hypothetical protein RhiirA4_411031 [Rhizophagus ... 61 2e-09 gb|PKC57418.1| hypothetical protein RhiirA1_428506, partial [Rhi... 57 3e-08 >gb|EXX55280.1| hypothetical protein RirG_226790 [Rhizophagus irregularis DAOM 197198w] dbj|GBC35321.1| hypothetical protein RIR_1991100 [Rhizophagus irregularis DAOM 181602] gb|PKB95428.1| hypothetical protein RhiirA5_507299 [Rhizophagus irregularis] gb|POG69728.1| hypothetical protein GLOIN_2v1623773 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 70 Score = 62.4 bits (150), Expect = 4e-10 Identities = 34/70 (48%), Positives = 36/70 (51%) Frame = -3 Query: 445 MSGDTLNAYXXXXXXXXXXXXXXXXXXXXLQSGREXXXXXXXXXXXLVFPVFGCLIYYFC 266 MS +TLNAY QS RE LVFPVFGCLIYYFC Sbjct: 1 MSSNTLNAYIGGILGFIILILDLIAIFEIFQSDREPLWKFIWVVFILVFPVFGCLIYYFC 60 Query: 265 SNRDKYKSKH 236 SNRDK+KSKH Sbjct: 61 SNRDKHKSKH 70 >gb|PKY56201.1| hypothetical protein RhiirA4_411031 [Rhizophagus irregularis] Length = 70 Score = 60.8 bits (146), Expect = 2e-09 Identities = 33/70 (47%), Positives = 35/70 (50%) Frame = -3 Query: 445 MSGDTLNAYXXXXXXXXXXXXXXXXXXXXLQSGREXXXXXXXXXXXLVFPVFGCLIYYFC 266 MS +TLNAY QS RE LVFP FGCLIYYFC Sbjct: 1 MSSNTLNAYIGGILGFIILILDLIAIFEIFQSDREPLWKFIWVVFILVFPAFGCLIYYFC 60 Query: 265 SNRDKYKSKH 236 SNRDK+KSKH Sbjct: 61 SNRDKHKSKH 70 >gb|PKC57418.1| hypothetical protein RhiirA1_428506, partial [Rhizophagus irregularis] gb|PKK77574.1| hypothetical protein RhiirC2_731621, partial [Rhizophagus irregularis] gb|PKY18920.1| hypothetical protein RhiirB3_406195, partial [Rhizophagus irregularis] Length = 68 Score = 57.4 bits (137), Expect = 3e-08 Identities = 32/68 (47%), Positives = 34/68 (50%) Frame = -3 Query: 445 MSGDTLNAYXXXXXXXXXXXXXXXXXXXXLQSGREXXXXXXXXXXXLVFPVFGCLIYYFC 266 MS +TLNAY QS RE LVFPVFGCLIYYFC Sbjct: 1 MSSNTLNAYIGGILGFIILILDLIAIFEIFQSDREPLWKFIWVVFILVFPVFGCLIYYFC 60 Query: 265 SNRDKYKS 242 SNRDK+KS Sbjct: 61 SNRDKHKS 68