BLASTX nr result
ID: Ophiopogon26_contig00053597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053597 (713 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC32079.1| hypothetical protein RIR_1726800 [Rhizophagus ir... 53 5e-11 dbj|GBC32080.1| hypothetical protein RIR_1726800 [Rhizophagus ir... 53 5e-11 >dbj|GBC32079.1| hypothetical protein RIR_1726800 [Rhizophagus irregularis DAOM 181602] Length = 138 Score = 53.1 bits (126), Expect(3) = 5e-11 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 711 FMNNEKDYTINWVEGSFFSQFDLSSMNREKEYDYK 607 F NNEKDYTINWVE DLSSMNREKEY+YK Sbjct: 62 FKNNEKDYTINWVE------VDLSSMNREKEYNYK 90 Score = 41.2 bits (95), Expect(3) = 5e-11 Identities = 22/35 (62%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -1 Query: 518 NNEKGISLQF---DLVINYLLSIEKRNIFTSASFK 423 N +KG+ +Q+ DLV NYLLSIEKRNIFTSA + Sbjct: 88 NYKKGLIVQWLEVDLVSNYLLSIEKRNIFTSAKLQ 122 Score = 21.2 bits (43), Expect(3) = 5e-11 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 319 FKIKKLQGIETLIGKSLRP 263 F KLQ IETLIG P Sbjct: 116 FTSAKLQKIETLIGNFSDP 134 >dbj|GBC32080.1| hypothetical protein RIR_1726800 [Rhizophagus irregularis DAOM 181602] Length = 81 Score = 53.1 bits (126), Expect(3) = 5e-11 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -3 Query: 711 FMNNEKDYTINWVEGSFFSQFDLSSMNREKEYDYK 607 F NNEKDYTINWVE DLSSMNREKEY+YK Sbjct: 5 FKNNEKDYTINWVE------VDLSSMNREKEYNYK 33 Score = 41.2 bits (95), Expect(3) = 5e-11 Identities = 22/35 (62%), Positives = 27/35 (77%), Gaps = 3/35 (8%) Frame = -1 Query: 518 NNEKGISLQF---DLVINYLLSIEKRNIFTSASFK 423 N +KG+ +Q+ DLV NYLLSIEKRNIFTSA + Sbjct: 31 NYKKGLIVQWLEVDLVSNYLLSIEKRNIFTSAKLQ 65 Score = 21.2 bits (43), Expect(3) = 5e-11 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 319 FKIKKLQGIETLIGKSLRP 263 F KLQ IETLIG P Sbjct: 59 FTSAKLQKIETLIGNFSDP 77