BLASTX nr result
ID: Ophiopogon26_contig00053547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053547 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC75531.1| hypothetical protein RhiirA1_448716 [Rhizophagus ... 92 1e-19 dbj|GBC50968.1| hypothetical protein RIR_3256200 [Rhizophagus ir... 88 1e-19 gb|PKK79847.1| hypothetical protein RhiirC2_860268 [Rhizophagus ... 91 1e-19 gb|PKY56639.1| hypothetical protein RhiirA4_477077 [Rhizophagus ... 84 1e-17 gb|PKC14961.1| hypothetical protein RhiirA5_371059 [Rhizophagus ... 82 1e-17 gb|PKY59126.1| hypothetical protein RhiirA4_514391 [Rhizophagus ... 85 1e-17 gb|PKK80864.1| hypothetical protein RhiirC2_357104 [Rhizophagus ... 56 9e-07 >gb|PKC75531.1| hypothetical protein RhiirA1_448716 [Rhizophagus irregularis] Length = 299 Score = 91.7 bits (226), Expect = 1e-19 Identities = 54/89 (60%), Positives = 61/89 (68%), Gaps = 7/89 (7%) Frame = +3 Query: 30 KRTRALLQGGNQILILRPNGKFLTWEIRSSPNLNGP----NAFQLFRMDYLNCY---SKD 188 KRTRALL N++LILRPN KFLTWEI S+ NL+ NAFQLFR+ Y SK Sbjct: 191 KRTRALLDE-NKVLILRPNEKFLTWEIPSAKNLDQQQRNLNAFQLFRLHYFKTLFNNSKH 249 Query: 189 RSIKTSKLSKINAEIIEAWNGSEKVREKY 275 SIK SKLSKIN E+ EAWN SE +RE Y Sbjct: 250 HSIKASKLSKINDEVNEAWNDSEIIRENY 278 >dbj|GBC50968.1| hypothetical protein RIR_3256200 [Rhizophagus irregularis DAOM 181602] Length = 147 Score = 88.2 bits (217), Expect = 1e-19 Identities = 53/93 (56%), Positives = 63/93 (67%), Gaps = 7/93 (7%) Frame = +3 Query: 18 SLSKKRTRALLQGGNQILILRPNGKFLTWEIRSSPNLNGP----NAFQLFRMDYLNCY-- 179 S K+RTRALL N++LILR N KFLTW+I S+ NL NAFQLFR+ Y Sbjct: 34 SALKRRTRALLDK-NEVLILRSNEKFLTWKIPSAENLEQQHRNLNAFQLFRLHYFKTLFN 92 Query: 180 -SKDRSIKTSKLSKINAEIIEAWNGSEKVREKY 275 SK RSIK SKL+KI+AEI EAWN SE ++E Y Sbjct: 93 NSKHRSIKASKLNKIHAEINEAWNDSEIIQENY 125 >gb|PKK79847.1| hypothetical protein RhiirC2_860268 [Rhizophagus irregularis] Length = 279 Score = 91.3 bits (225), Expect = 1e-19 Identities = 54/89 (60%), Positives = 60/89 (67%), Gaps = 7/89 (7%) Frame = +3 Query: 30 KRTRALLQGGNQILILRPNGKFLTWEIRSSPNLNGP----NAFQLFRMDYLNCY---SKD 188 KRTRALL N +LILRPN KFLTWEI S+ NL+ NAFQLFR+ Y SK Sbjct: 171 KRTRALLDENN-VLILRPNEKFLTWEIPSAKNLDQQQRNLNAFQLFRLHYFKTLFNNSKH 229 Query: 189 RSIKTSKLSKINAEIIEAWNGSEKVREKY 275 SIK SKLSKIN E+ EAWN SE +RE Y Sbjct: 230 HSIKASKLSKINDEVNEAWNDSEIIRENY 258 >gb|PKY56639.1| hypothetical protein RhiirA4_477077 [Rhizophagus irregularis] Length = 167 Score = 83.6 bits (205), Expect = 1e-17 Identities = 48/85 (56%), Positives = 57/85 (67%), Gaps = 3/85 (3%) Frame = +3 Query: 30 KRTRALLQG-GNQILILRPNGKFLTWEIR-SSPNLNGPNAFQLFRMDYLNCYSKDR-SIK 200 K TRAL NQ+LILR NGKF W +R + NL + FQ F+MDY N + R +I Sbjct: 28 KGTRALFDSDSNQVLILRSNGKFFRWSLRLTRKNLFKRSGFQHFKMDYWNTVKRSRKTIN 87 Query: 201 TSKLSKINAEIIEAWNGSEKVREKY 275 SKLSKINAEIIEAW+ S+KVRE Y Sbjct: 88 ASKLSKINAEIIEAWDNSDKVREIY 112 >gb|PKC14961.1| hypothetical protein RhiirA5_371059 [Rhizophagus irregularis] gb|PKY16302.1| hypothetical protein RhiirB3_428645 [Rhizophagus irregularis] Length = 126 Score = 82.4 bits (202), Expect = 1e-17 Identities = 50/89 (56%), Positives = 58/89 (65%), Gaps = 7/89 (7%) Frame = +3 Query: 30 KRTRALLQGGNQILILRPNGKFLTWEIRSSPNLNGP----NAFQLFRMDYLNCY---SKD 188 K+ RA+L N++LILR N KFLTWEI NL NAFQLFR+ Y SK Sbjct: 16 KKPRAILDK-NKVLILRSNEKFLTWEIPLVENLEPQQRKMNAFQLFRLHYFKTLFSNSKH 74 Query: 189 RSIKTSKLSKINAEIIEAWNGSEKVREKY 275 RSIK SKL+KINAEI EAWN SE +R+ Y Sbjct: 75 RSIKASKLNKINAEINEAWNDSEIIRKNY 103 >gb|PKY59126.1| hypothetical protein RhiirA4_514391 [Rhizophagus irregularis] Length = 240 Score = 85.1 bits (209), Expect = 1e-17 Identities = 52/98 (53%), Positives = 63/98 (64%), Gaps = 10/98 (10%) Frame = +3 Query: 30 KRTRALL-QGGNQILILRPNGKFLTWEIR-SSPNL---NGP----NAFQLFRMDYLNCYS 182 K TRAL NQ+LILR NGKFL W +R + NL NG N FQLF+MDY Sbjct: 32 KGTRALFGSDDNQVLILRSNGKFLMWSLRLTRKNLLKRNGDKQIANGFQLFKMDYWKTVK 91 Query: 183 KDR-SIKTSKLSKINAEIIEAWNGSEKVREKYLFSHSK 293 + + +I SKL KINAEIIEAWN S+KVRE Y++ +K Sbjct: 92 RSKKTINASKLGKINAEIIEAWNNSDKVREIYIYQTAK 129 >gb|PKK80864.1| hypothetical protein RhiirC2_357104 [Rhizophagus irregularis] Length = 208 Score = 55.8 bits (133), Expect = 9e-07 Identities = 31/72 (43%), Positives = 45/72 (62%), Gaps = 1/72 (1%) Frame = +3 Query: 63 QILILRPNGKFLTWEIRSSPNLNGPNAFQLFRMDYLNCYSKDRSIKTSKLSKINAEIIEA 242 QI++L+PN +FLTW I N N+FQLF+ YL + + + K +AEIIEA Sbjct: 13 QIIVLKPNYEFLTWIIPIDSPSNLKNSFQLFKQHYLEAMGEHLQVDSEK----DAEIIEA 68 Query: 243 WNGSE-KVREKY 275 W+ S+ +VRE+Y Sbjct: 69 WDCSDMQVREEY 80