BLASTX nr result
ID: Ophiopogon26_contig00053485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053485 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC53872.1| hypothetical protein RhiirA1_447190 [Rhizophagus ... 57 2e-07 gb|PKY35181.1| hypothetical protein RhiirB3_533081 [Rhizophagus ... 57 2e-07 dbj|GBC36593.1| hypothetical protein RIR_2096500 [Rhizophagus ir... 57 3e-07 >gb|PKC53872.1| hypothetical protein RhiirA1_447190 [Rhizophagus irregularis] Length = 223 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 78 MGLNMYENMADELPKDLAKWSVINVETYLRFKM 176 MG N YE MADELPKD+AKWSV +VETYL FKM Sbjct: 1 MGFNRYEKMADELPKDVAKWSVDDVETYLTFKM 33 >gb|PKY35181.1| hypothetical protein RhiirB3_533081 [Rhizophagus irregularis] Length = 236 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 78 MGLNMYENMADELPKDLAKWSVINVETYLRFKM 176 MG N YE MADELPKD+AKWSV +VETYL FKM Sbjct: 1 MGFNRYEKMADELPKDVAKWSVDDVETYLTFKM 33 >dbj|GBC36593.1| hypothetical protein RIR_2096500 [Rhizophagus irregularis DAOM 181602] gb|POG66227.1| hypothetical protein GLOIN_2v1658883 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 236 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 78 MGLNMYENMADELPKDLAKWSVINVETYLRFKM 176 MG N YE MADELPKD+AKWS+ +VETYL FKM Sbjct: 1 MGFNRYEKMADELPKDVAKWSIDDVETYLTFKM 33