BLASTX nr result
ID: Ophiopogon26_contig00053475
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053475 (645 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK38515.1| unknown [Lotus japonicus] 62 8e-09 ref|XP_004833131.1| 40S ribosomal protein S25, putative [Theiler... 61 1e-08 ref|XP_001420787.1| Ribosomal protein S25, component of cytosoli... 58 8e-08 gb|OEU17339.1| ribosomal protein S25 [Fragilariopsis cylindrus C... 58 2e-07 ref|XP_003061133.1| predicted protein [Micromonas pusilla CCMP15... 57 3e-07 sp|Q94G66.1|RS25_AMACR RecName: Full=40S ribosomal protein S25 >... 57 3e-07 gb|KYQ92458.1| 40S ribosomal protein S25 [Tieghemostelium lacteum] 57 4e-07 ref|XP_013333232.1| R1 protein, putative [Eimeria maxima] >gi|55... 58 5e-07 gb|OUS42996.1| ribosomal protein S25, partial [Ostreococcus tauri] 56 7e-07 ref|XP_022840092.1| Taurine catabolism dioxygenase TauD/TfdA [Os... 56 8e-07 gb|OAO11943.1| ribosomal protein S25 [Blastocystis sp. ATCC 5017... 55 9e-07 ref|XP_003294856.1| hypothetical protein DICPUDRAFT_159931 [Dict... 59 9e-07 gb|EJK64206.1| hypothetical protein THAOC_15085 [Thalassiosira o... 57 9e-07 ref|XP_002185875.1| predicted protein [Phaeodactylum tricornutum... 56 1e-06 ref|XP_007511926.1| predicted protein [Bathycoccus prasinos] >gi... 55 1e-06 ref|XP_002503116.1| predicted protein, partial [Micromonas commo... 55 2e-06 dbj|GAX76493.1| hypothetical protein CEUSTIGMA_g3938.t1 [Chlamyd... 55 2e-06 ref|XP_009117386.1| PREDICTED: 40S ribosomal protein S25-4 [Bras... 55 2e-06 dbj|GAX28824.1| small subunit ribosomal protein S25e [Fistulifer... 55 2e-06 ref|XP_013248471.1| R1 protein, putative [Eimeria acervulina] >g... 55 3e-06 >gb|AFK38515.1| unknown [Lotus japonicus] Length = 143 Score = 62.4 bits (150), Expect = 8e-09 Identities = 32/67 (47%), Positives = 45/67 (67%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN VVF KEL+ K L +VP K+ITI ++++ ++N SLARR +REL AK I+P+ S Sbjct: 38 NNAVVFDKELYDKLLKEVPTS-KLITISSIIDKLRINGSLARRALRELAAKDLIRPVALS 96 Query: 310 GTMAVYT 330 +YT Sbjct: 97 HAQFIYT 103 >ref|XP_004833131.1| 40S ribosomal protein S25, putative [Theileria equi] gb|EKX73679.1| 40S ribosomal protein S25, putative [Theileria equi strain WA] Length = 105 Score = 60.8 bits (146), Expect = 1e-08 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPIC-P 306 NN V+F K + K L D+PK K+ITI ++VE KVN SLAR I+EL K I+PIC P Sbjct: 37 NNSVIFDKATYDKLLADIPKN-KLITISSIVERLKVNGSLARLAIKELEGKNLIKPICEP 95 Query: 307 SGTMAVYT 330 +YT Sbjct: 96 HHAQLLYT 103 >ref|XP_001420787.1| Ribosomal protein S25, component of cytosolic 80S ribosome and 40S small subunit, partial [Ostreococcus lucimarinus CCE9901] gb|ABO99080.1| Ribosomal protein S25, component of cytosolic 80S ribosome and 40S small subunit, partial [Ostreococcus lucimarinus CCE9901] Length = 84 Score = 58.2 bits (139), Expect = 8e-08 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN+V+F + + K L +VPK K+ITI L + ++ CSLAR+GI LLAKG I+P+ Sbjct: 12 NNQVLFEQSTYDKLLAEVPK-YKMITISILCDRLRITCSLARKGIAILLAKGLIKPLVLH 70 Query: 310 GTMAVYT 330 +YT Sbjct: 71 SKQHIYT 77 >gb|OEU17339.1| ribosomal protein S25 [Fragilariopsis cylindrus CCMP1102] Length = 113 Score = 58.2 bits (139), Expect = 2e-07 Identities = 30/67 (44%), Positives = 46/67 (68%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 +N+V F+KE F +F +VPK +K+IT+ +VE K+N LARR +R+L A G I+P+ S Sbjct: 38 DNKVRFSKEQFERFHDEVPK-MKLITVSAVVEKLKINGGLARRALRDLEADGKIRPVLIS 96 Query: 310 GTMAVYT 330 + +YT Sbjct: 97 RSQRIYT 103 >ref|XP_003061133.1| predicted protein [Micromonas pusilla CCMP1545] gb|EEH54783.1| predicted protein [Micromonas pusilla CCMP1545] Length = 109 Score = 57.4 bits (137), Expect = 3e-07 Identities = 29/67 (43%), Positives = 43/67 (64%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN+V+F + + K L +VPK K+ITI L + ++ CSLAR+ I+ L+AKG I+P+ Sbjct: 37 NNQVLFEQSTYDKLLAEVPK-YKMITISILCDRLRITCSLARKAIQILIAKGLIRPVTMH 95 Query: 310 GTMAVYT 330 VYT Sbjct: 96 SKQQVYT 102 >sp|Q94G66.1|RS25_AMACR RecName: Full=40S ribosomal protein S25 gb|AAK58369.1|AF268028_1 ribosomal protein S25 [Amaranthus hybridus subsp. cruentus] Length = 114 Score = 57.4 bits (137), Expect = 3e-07 Identities = 29/67 (43%), Positives = 43/67 (64%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN V+F F K L + K+ KV+T L E F++N SLARR IREL+++G I+ +C Sbjct: 37 NNLVLFDNATFDKLLSEAGKQ-KVVTAATLSERFRINGSLARRAIRELVSRGAIKMVCHH 95 Query: 310 GTMAVYT 330 ++ +YT Sbjct: 96 SSLQIYT 102 >gb|KYQ92458.1| 40S ribosomal protein S25 [Tieghemostelium lacteum] Length = 112 Score = 57.0 bits (136), Expect = 4e-07 Identities = 31/67 (46%), Positives = 42/67 (62%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN ++F K+ +AK L D+P KVIT + + K N SLARR I+ELL+KG I+ + S Sbjct: 42 NNMILFDKDTYAKLLKDIPTA-KVITTATISDRMKCNGSLARRAIKELLSKGLIRQVIRS 100 Query: 310 GTMAVYT 330 VYT Sbjct: 101 HGNGVYT 107 >ref|XP_013333232.1| R1 protein, putative [Eimeria maxima] emb|CDJ56581.1| R1 protein, putative [Eimeria maxima] Length = 150 Score = 57.8 bits (138), Expect = 5e-07 Identities = 28/60 (46%), Positives = 41/60 (68%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 N V+F + KF+ +VPK +K++T Y + E ++N SLARRGIREL +KG I+P+ S Sbjct: 68 NYAVMFDQATLDKFMAEVPK-MKLVTPYTICERLRINASLARRGIRELYSKGLIRPLVES 126 >gb|OUS42996.1| ribosomal protein S25, partial [Ostreococcus tauri] Length = 107 Score = 56.2 bits (134), Expect = 7e-07 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN+V+F + + K L +VPK K+IT L + ++ CSLAR+GI L AKG I+P+ Sbjct: 37 NNQVLFEQSTYDKLLAEVPK-YKMITTAVLCDRLRITCSLARKGIAILQAKGLIKPLVSH 95 Query: 310 GTMAVYT 330 + VYT Sbjct: 96 AALNVYT 102 >ref|XP_022840092.1| Taurine catabolism dioxygenase TauD/TfdA [Ostreococcus tauri] emb|CEF99886.1| Taurine catabolism dioxygenase TauD/TfdA [Ostreococcus tauri] Length = 108 Score = 56.2 bits (134), Expect = 8e-07 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN+V+F + + K L +VPK K+IT L + ++ CSLAR+GI L AKG I+P+ Sbjct: 37 NNQVLFEQSTYDKLLAEVPK-YKMITTAVLCDRLRITCSLARKGIAILQAKGLIKPLVSH 95 Query: 310 GTMAVYT 330 + VYT Sbjct: 96 AALNVYT 102 >gb|OAO11943.1| ribosomal protein S25 [Blastocystis sp. ATCC 50177/Nand II] gb|OAO15839.1| 40S ribosomal protein S25 [Blastocystis sp. ATCC 50177/Nand II] Length = 86 Score = 55.5 bits (132), Expect = 9e-07 Identities = 28/61 (45%), Positives = 40/61 (65%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN+V F K + K L +VPK +K+IT+Y +V+ K+N S AR GIREL+ +G I + Sbjct: 19 NNKVYFEKADYDKLLAEVPK-MKLITVYGIVDRLKINGSCARAGIRELVKQGKIVEVSKR 77 Query: 310 G 312 G Sbjct: 78 G 78 >ref|XP_003294856.1| hypothetical protein DICPUDRAFT_159931 [Dictyostelium purpureum] gb|EGC28618.1| hypothetical protein DICPUDRAFT_159931 [Dictyostelium purpureum] Length = 376 Score = 59.3 bits (142), Expect = 9e-07 Identities = 34/67 (50%), Positives = 43/67 (64%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN V+F KE +AK L ++P KVIT + E K+N SLARR IRELL+KG I+ + S Sbjct: 308 NNAVLFDKETYAKLLKEIPTA-KVITTAVVSERIKINGSLARRAIRELLSKGLIKQVIRS 366 Query: 310 GTMAVYT 330 VYT Sbjct: 367 HGNGVYT 373 >gb|EJK64206.1| hypothetical protein THAOC_15085 [Thalassiosira oceanica] Length = 149 Score = 57.0 bits (136), Expect = 9e-07 Identities = 27/67 (40%), Positives = 44/67 (65%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 +N+V+FTKE + +VPK +K+IT+ +VE K++ LARR + +L +G I+P+C S Sbjct: 76 DNKVLFTKEQHERLNSEVPK-MKLITVSAVVEKLKISGGLARRALNQLAEEGAIRPVCTS 134 Query: 310 GTMAVYT 330 +YT Sbjct: 135 RAQRIYT 141 >ref|XP_002185875.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] gb|ACI65345.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] Length = 110 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/67 (40%), Positives = 45/67 (67%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 +N+V+ +KE F + +VPK +K+IT+ +VE K++ LARR +R+L +G I+P+C S Sbjct: 38 DNKVLMSKEQFDRLHEEVPK-MKLITVSAVVEKLKISGGLARRALRDLADEGKIRPVCLS 96 Query: 310 GTMAVYT 330 +YT Sbjct: 97 RAQQIYT 103 >ref|XP_007511926.1| predicted protein [Bathycoccus prasinos] emb|CCO66014.1| predicted protein [Bathycoccus prasinos] Length = 108 Score = 55.5 bits (132), Expect = 1e-06 Identities = 28/66 (42%), Positives = 42/66 (63%) Frame = +1 Query: 133 NRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPSG 312 N+V+F + + K L +VPK K+IT+ L + ++ CSLAR+GI L+AKG I+P+ Sbjct: 38 NQVLFEQSTYDKLLAEVPK-YKMITVSILCDRLRITCSLARKGIAILVAKGLIKPVVRHS 96 Query: 313 TMAVYT 330 VYT Sbjct: 97 QQDVYT 102 >ref|XP_002503116.1| predicted protein, partial [Micromonas commoda] gb|ACO64374.1| predicted protein, partial [Micromonas commoda] Length = 87 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/67 (40%), Positives = 42/67 (62%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN+V+F + + K L +VPK K+I+I L + ++ CSLAR+ I L+AKG I+P+ Sbjct: 15 NNQVLFEQSTYDKLLAEVPK-YKMISISILTDRLRITCSLARKAIAILIAKGLIKPVTLH 73 Query: 310 GTMAVYT 330 +YT Sbjct: 74 SKQQIYT 80 >dbj|GAX76493.1| hypothetical protein CEUSTIGMA_g3938.t1 [Chlamydomonas eustigma] Length = 89 Score = 54.7 bits (130), Expect = 2e-06 Identities = 30/67 (44%), Positives = 41/67 (61%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN V+F K L+ K LV+VPK K+IT L + ++ SLAR IREL +KG I+P+ Sbjct: 19 NNAVLFEKPLYEKLLVEVPK-YKMITPSILSDRMRIGGSLARAAIRELASKGLIRPLVKH 77 Query: 310 GTMAVYT 330 +YT Sbjct: 78 SKQLIYT 84 >ref|XP_009117386.1| PREDICTED: 40S ribosomal protein S25-4 [Brassica rapa] Length = 108 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 NN V+F + + K L + PK LK+IT L + ++N SLARR IREL+AKG I+ + Sbjct: 38 NNMVLFDQATYDKLLTEAPK-LKLITPSILSDRMRINGSLARRAIRELMAKGVIRMVAAH 96 Query: 310 GTMAVYT 330 + +YT Sbjct: 97 SSQQIYT 103 >dbj|GAX28824.1| small subunit ribosomal protein S25e [Fistulifera solaris] dbj|GAX16310.1| small subunit ribosomal protein S25e [Fistulifera solaris] Length = 98 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/67 (41%), Positives = 44/67 (65%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPICPS 309 +N+V+ +KE F + +VPK +K+IT+ +VE KVN LARR +R+L +G I+P+ S Sbjct: 25 DNKVLLSKEQFDRLHEEVPK-MKLITVSAVVEKLKVNGGLARRALRDLAEEGKIRPVLLS 83 Query: 310 GTMAVYT 330 +YT Sbjct: 84 RAQQIYT 90 >ref|XP_013248471.1| R1 protein, putative [Eimeria acervulina] emb|CDI81978.1| R1 protein, putative [Eimeria acervulina] Length = 108 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/57 (45%), Positives = 40/57 (70%) Frame = +1 Query: 130 NNRVVFTKELFAKFLVDVPKKLKVITIYNLVENFKVNCSLARRGIRELLAKGTIQPI 300 N V+F + KF+ +VPK +K++T Y + E ++N SLARRGIREL ++G I+P+ Sbjct: 37 NYAVMFDQATLDKFMAEVPK-MKLVTPYTICERLRINASLARRGIRELHSQGLIKPL 92