BLASTX nr result
ID: Ophiopogon26_contig00053365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053365 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC41542.1| hypothetical protein RIR_2491300 [Rhizophagus ir... 67 9e-12 >dbj|GBC41542.1| hypothetical protein RIR_2491300 [Rhizophagus irregularis DAOM 181602] Length = 92 Score = 67.4 bits (163), Expect = 9e-12 Identities = 39/74 (52%), Positives = 41/74 (55%) Frame = +2 Query: 116 FCSKPQDIQPSLNCPFYKYMNFSRTSGLRSRLNVL*IDITPFKGLS*KVPRHGFLML*FS 295 FCSKPQ IQPSL CP YKYMNFSR +GLRSRLN FS Sbjct: 41 FCSKPQAIQPSLYCPIYKYMNFSRITGLRSRLN-------------------------FS 75 Query: 296 RLIINSPH*RLFIF 337 RLIINSP + F F Sbjct: 76 RLIINSPPLKTFNF 89