BLASTX nr result
ID: Ophiopogon26_contig00053315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053315 (625 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK68595.1| hypothetical protein RhiirC2_534396 [Rhizophagus ... 54 1e-06 >gb|PKK68595.1| hypothetical protein RhiirC2_534396 [Rhizophagus irregularis] Length = 60 Score = 54.3 bits (129), Expect = 1e-06 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = +2 Query: 437 IY*GTNDSINVIFSSLDRSHSLLSNKYKFIFLAYIYIELFMILQQELYLIFNL 595 IY +++ IN IF+ DR H LSNK K I AY+Y++LF IL QELYLI L Sbjct: 6 IYSSSSELINAIFNLSDRPHFPLSNKCKIIHSAYMYVKLFTILFQELYLILIL 58