BLASTX nr result
ID: Ophiopogon26_contig00053313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053313 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC24532.1| Tis13_25641 [Rhizophagus irregularis DAOM 181602] 63 6e-10 >dbj|GBC24532.1| Tis13_25641 [Rhizophagus irregularis DAOM 181602] Length = 68 Score = 63.2 bits (152), Expect = 6e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 223 QEQLLWRDIETSKYNLLLINAQIESIRNGKVLIQQLNY 336 +++LL RD ETS+YNLLLIN QIESIRNGKVLIQQLNY Sbjct: 31 KKELLRRDTETSEYNLLLINTQIESIRNGKVLIQQLNY 68