BLASTX nr result
ID: Ophiopogon26_contig00053253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053253 (604 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC38166.1| Tis13_84865 [Rhizophagus irregularis DAOM 181602] 66 2e-10 >dbj|GBC38166.1| Tis13_84865 [Rhizophagus irregularis DAOM 181602] Length = 130 Score = 65.9 bits (159), Expect = 2e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +2 Query: 314 RRVLVSSDPICERKEKLYQLGFLRKIQLKFHNVI 415 RRVLVSSDPICERKEKLYQLGFLRKIQL F NVI Sbjct: 20 RRVLVSSDPICERKEKLYQLGFLRKIQLMFRNVI 53