BLASTX nr result
ID: Ophiopogon26_contig00053175
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053175 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272290.1| RING-H2 finger protein ATL66-like [Asparagus... 61 6e-09 ref|XP_022884551.1| E3 ubiquitin-protein ligase RING1-like [Olea... 55 5e-06 >ref|XP_020272290.1| RING-H2 finger protein ATL66-like [Asparagus officinalis] Length = 180 Score = 61.2 bits (147), Expect = 6e-09 Identities = 31/57 (54%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Frame = -1 Query: 388 FHVSCVDKWLRSSSKCPVCRADVLSDD---NNLQLSGMGTNSLETLPVER*TSSGNC 227 FHVSCVD WLRSSS CP+CR +VL DD ++L SG ++ETLP E T C Sbjct: 111 FHVSCVDIWLRSSSSCPLCRNNVLKDDGSSSSLPGSGTAIRAMETLPREEPTQGTAC 167 >ref|XP_022884551.1| E3 ubiquitin-protein ligase RING1-like [Olea europaea var. sylvestris] Length = 390 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/46 (50%), Positives = 31/46 (67%) Frame = -1 Query: 388 FHVSCVDKWLRSSSKCPVCRADVLSDDNNLQLSGMGTNSLETLPVE 251 FHV C+D WLRS CPVCRA ++S+ N+ +S + TNS + P E Sbjct: 168 FHVPCIDTWLRSHQNCPVCRAPIVSNTNSAPVSSVLTNSNDLAPRE 213