BLASTX nr result
ID: Ophiopogon26_contig00053138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053138 (917 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC24054.1| Tis13_8291 [Rhizophagus irregularis DAOM 181602] 69 3e-26 gb|EXX63918.1| hypothetical protein RirG_147840 [Rhizophagus irr... 52 9e-12 >dbj|GBC24054.1| Tis13_8291 [Rhizophagus irregularis DAOM 181602] Length = 97 Score = 68.9 bits (167), Expect(3) = 3e-26 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +3 Query: 384 IHFDAIKEMSKGVVEISQGQARTIKDLSSVMQQQRS 491 IHFDAIKEMSKGVVE+SQGQ RTIKDLSSVMQQQRS Sbjct: 62 IHFDAIKEMSKGVVELSQGQTRTIKDLSSVMQQQRS 97 Score = 52.0 bits (123), Expect(3) = 3e-26 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +1 Query: 133 MEAEDEVDQSPQSLNRSLHYHTYQFN 210 MEAEDEVDQSPQSL RSLHYHTY N Sbjct: 1 MEAEDEVDQSPQSLKRSLHYHTYSIN 26 Score = 47.4 bits (111), Expect(3) = 3e-26 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 185 YIIIHINSIMEAVNEELNMSPKTCSWFKISTPS 283 Y IN IME VNEEL MSPKT SW KISTPS Sbjct: 20 YHTYSINPIMEVVNEELYMSPKTRSWSKISTPS 52 >gb|EXX63918.1| hypothetical protein RirG_147840 [Rhizophagus irregularis DAOM 197198w] Length = 63 Score = 52.0 bits (123), Expect(2) = 9e-12 Identities = 23/26 (88%), Positives = 23/26 (88%) Frame = +1 Query: 133 MEAEDEVDQSPQSLNRSLHYHTYQFN 210 MEAEDEVDQSPQSL RSLHYHTY N Sbjct: 1 MEAEDEVDQSPQSLKRSLHYHTYSIN 26 Score = 47.4 bits (111), Expect(2) = 9e-12 Identities = 24/33 (72%), Positives = 24/33 (72%) Frame = +2 Query: 185 YIIIHINSIMEAVNEELNMSPKTCSWFKISTPS 283 Y IN IME VNEEL MSPKT SW KISTPS Sbjct: 20 YHTYSINPIMEVVNEELYMSPKTRSWSKISTPS 52