BLASTX nr result
ID: Ophiopogon26_contig00053128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053128 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXX56683.1| hypothetical protein RirG_213910 [Rhizophagus irr... 102 2e-40 >gb|EXX56683.1| hypothetical protein RirG_213910 [Rhizophagus irregularis DAOM 197198w] dbj|GBC17048.1| hypothetical protein RIR_0504800 [Rhizophagus irregularis DAOM 181602] gb|PKC14340.1| hypothetical protein RhiirA5_350456 [Rhizophagus irregularis] gb|PKC59397.1| hypothetical protein RhiirA1_492997 [Rhizophagus irregularis] gb|PKK65264.1| hypothetical protein RhiirC2_853739 [Rhizophagus irregularis] gb|PKY28946.1| hypothetical protein RhiirB3_417552 [Rhizophagus irregularis] gb|PKY54310.1| hypothetical protein RhiirA4_409735 [Rhizophagus irregularis] gb|POG57690.1| hypothetical protein GLOIN_2v1737669 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 243 Score = 102 bits (253), Expect(2) = 2e-40 Identities = 48/51 (94%), Positives = 50/51 (98%) Frame = -1 Query: 155 PAFEAFLNQRVSLTTDQMDRIELARLHANVDKLPPRYPAQDGYLRKDIHKM 3 PAFEAFLNQRVSLTTDQ+DRIELA+LHANVDKLP RYPAQDGYLRKDIHKM Sbjct: 92 PAFEAFLNQRVSLTTDQLDRIELAKLHANVDKLPQRYPAQDGYLRKDIHKM 142 Score = 92.0 bits (227), Expect(2) = 2e-40 Identities = 48/76 (63%), Positives = 56/76 (73%), Gaps = 1/76 (1%) Frame = -3 Query: 384 SRCTINTVSNHYYNHLSTSSKVAAETDLSTSKYSVITKDSTT-PHLPTCKCVSCKEQLEI 208 SRCTINT+SNH+YN+L E SK++ K ST PHLPTCKCV+CKEQLE Sbjct: 22 SRCTINTLSNHHYNNLP-------EPPSPDSKFTAELKSSTKIPHLPTCKCVACKEQLES 74 Query: 207 RLAHDAIVEEVAKKIE 160 RLAHDAIVEEVAKK++ Sbjct: 75 RLAHDAIVEEVAKKLK 90