BLASTX nr result
ID: Ophiopogon26_contig00053030
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053030 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC05423.1| hypothetical protein RhiirA5_361343 [Rhizophagus ... 69 6e-13 >gb|PKC05423.1| hypothetical protein RhiirA5_361343 [Rhizophagus irregularis] gb|PKC67162.1| hypothetical protein RhiirA1_418473 [Rhizophagus irregularis] gb|PKY30186.1| hypothetical protein RhiirB3_418609 [Rhizophagus irregularis] Length = 66 Score = 68.6 bits (166), Expect = 6e-13 Identities = 32/66 (48%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Frame = +1 Query: 88 MTSLNTKNSKVGKRET-KKTKDEKAYDNRQRIIQANQERQLPIHVHQMNLTTKEVKSTEP 264 MTSLNTKNSKV K + K+ +E+ Y R+++I+ + +R+ +H+H NLTT +VK T+P Sbjct: 1 MTSLNTKNSKVTKNQRPKRQSEEEKYKLREKVIKDDADRKKKLHLHSTNLTTSQVKDTKP 60 Query: 265 QHPYNR 282 Q PY+R Sbjct: 61 QPPYDR 66