BLASTX nr result
ID: Ophiopogon26_contig00053019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00053019 (621 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GBC36986.1| hypothetical protein RIR_2123600 [Rhizophagus ir... 60 6e-07 >dbj|GBC36986.1| hypothetical protein RIR_2123600 [Rhizophagus irregularis DAOM 181602] Length = 369 Score = 59.7 bits (143), Expect = 6e-07 Identities = 33/62 (53%), Positives = 42/62 (67%) Frame = -1 Query: 186 KQYHEDQASGNENTSHKRQCHQIKKENDESPRTPEDNIRTVTFDEEESSISAMSYIPAIP 7 K + D ++ S +Q ++K+ +PRTPED RTVTF+EEESS SAMSYIPAIP Sbjct: 21 KIFRIDILDNIDHVSSFKQPLDLEKDGT-NPRTPEDKKRTVTFEEEESSTSAMSYIPAIP 79 Query: 6 VE 1 VE Sbjct: 80 VE 81