BLASTX nr result
ID: Ophiopogon26_contig00052888
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052888 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKY54458.1| hypothetical protein RhiirA4_501543 [Rhizophagus ... 60 7e-12 gb|EXX57712.1| hypothetical protein RirG_204620 [Rhizophagus irr... 60 7e-12 >gb|PKY54458.1| hypothetical protein RhiirA4_501543 [Rhizophagus irregularis] Length = 733 Score = 60.1 bits (144), Expect(2) = 7e-12 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 182 VKQTLVNISRPVTPIIVKLATSDKNLTTSAIKSYGF 289 VKQTLVNI RP T II+KLAT+DKN TTSAIK+YGF Sbjct: 170 VKQTLVNICRPATAIIIKLATADKNSTTSAIKTYGF 205 Score = 37.7 bits (86), Expect(2) = 7e-12 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 120 MQYLMEHNHGWEYLSFCFINK 182 MQ LMEH+HGWE L F FINK Sbjct: 144 MQNLMEHDHGWEDLGFDFINK 164 >gb|EXX57712.1| hypothetical protein RirG_204620 [Rhizophagus irregularis DAOM 197198w] dbj|GBC48551.1| elmo/ced-12 family protein [Rhizophagus irregularis DAOM 181602] gb|PKC14741.1| hypothetical protein RhiirA5_451698 [Rhizophagus irregularis] gb|PKC60598.1| hypothetical protein RhiirA1_539730 [Rhizophagus irregularis] gb|PKK67127.1| hypothetical protein RhiirC2_683689 [Rhizophagus irregularis] gb|PKY19530.1| hypothetical protein RhiirB3_523583 [Rhizophagus irregularis] gb|POG69973.1| hypothetical protein GLOIN_2v1752839 [Rhizophagus irregularis DAOM 181602=DAOM 197198] Length = 733 Score = 60.1 bits (144), Expect(2) = 7e-12 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +2 Query: 182 VKQTLVNISRPVTPIIVKLATSDKNLTTSAIKSYGF 289 VKQTLVNI RP T II+KLAT+DKN TTSAIK+YGF Sbjct: 170 VKQTLVNICRPATAIIIKLATADKNSTTSAIKTYGF 205 Score = 37.7 bits (86), Expect(2) = 7e-12 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +3 Query: 120 MQYLMEHNHGWEYLSFCFINK 182 MQ LMEH+HGWE L F FINK Sbjct: 144 MQNLMEHDHGWEDLGFDFINK 164