BLASTX nr result
ID: Ophiopogon26_contig00052879
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00052879 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC10269.1| hypothetical protein RhiirA5_355713 [Rhizophagus ... 110 8e-29 dbj|GBC50328.1| hypothetical protein RIR_3207600 [Rhizophagus ir... 91 5e-21 >gb|PKC10269.1| hypothetical protein RhiirA5_355713 [Rhizophagus irregularis] gb|PKK76362.1| hypothetical protein RhiirC2_734399 [Rhizophagus irregularis] gb|PKY48823.1| hypothetical protein RhiirA4_404789 [Rhizophagus irregularis] Length = 80 Score = 110 bits (275), Expect = 8e-29 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = -1 Query: 372 EDINRARIVALAVKEACAILSSEQSQKDGWEAARQLILKNKLLTEDEKKNIIFLLQPK 199 EDINRARIVALAVKEAC+ILSSEQSQKDGWEAARQLILKNKLLTEDEKKNII LLQPK Sbjct: 5 EDINRARIVALAVKEACSILSSEQSQKDGWEAARQLILKNKLLTEDEKKNIILLLQPK 62 >dbj|GBC50328.1| hypothetical protein RIR_3207600 [Rhizophagus irregularis DAOM 181602] Length = 83 Score = 90.9 bits (224), Expect = 5e-21 Identities = 48/56 (85%), Positives = 50/56 (89%) Frame = -1 Query: 456 IYTNIEITKRKVMPIKEPEMDIANTAGEEDINRARIVALAVKEACAILSSEQSQKD 289 +YTNIEITKRKVMPIKEPEMDI EDINRARIVALAVKEAC+ILSSEQSQKD Sbjct: 8 VYTNIEITKRKVMPIKEPEMDIG-----EDINRARIVALAVKEACSILSSEQSQKD 58